Prionailurus viverrinus (fishing cat): 125166621 Help Entry 125166621         CDS       T09889                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04613   Neutrophil extracellular trap formation pviv05034   Alcoholism pviv05203   Viral carcinogenesis pviv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pviv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125166621  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125166621   09163 Immune disease    05322 Systemic lupus erythematosus     125166621   09165 Substance dependence    05034 Alcoholism     125166621  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pviv03036]     125166621 Chromosome and associated proteins [BR:pviv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125166621 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  125166621 NCBI-ProteinID:  XP_047716502 LinkDB All DBs Position B2:complement(3502463..3502935) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgtggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

DBGET integrated database retrieval system