Prionailurus viverrinus (fishing cat): 125168447 Help Entry 125168447         CDS       T09889                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04015   Rap1 signaling pathway pviv04810   Regulation of actin cytoskeleton pviv05014   Amyotrophic lateral sclerosis pviv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125168447  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125168447  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125168447   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125168447  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pviv04131]     125168447   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pviv04812]     125168447    04147 Exosome [BR:pviv04147]     125168447 Membrane trafficking [BR:pviv04131]  Others   Actin-binding proteins    Others     125168447 Cytoskeleton proteins [BR:pviv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125168447 Exosome [BR:pviv04147]  Exosomal proteins   Proteins found in most exosomes    125168447 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125168447 NCBI-ProteinID:  XP_047719539 LinkDB All DBs Position B3:29723376..29723902 Genome browser AA seq 128 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKC NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaacgggctgacacttgggggccagaaatgctctgttatccgggactcgctgctgcag gacggggaatttaccatggatctccgtaccaagagcaccggcggagctcccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcgggatgatcaacaagaaatgttag

DBGET integrated database retrieval system