Prionailurus viverrinus (fishing cat): 125170045 Help Entry 125170045         CDS       T09889                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04015   Rap1 signaling pathway pviv04810   Regulation of actin cytoskeleton pviv05014   Amyotrophic lateral sclerosis pviv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125170045 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125170045 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125170045 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125170045 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pviv04131]     125170045 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pviv04812]     125170045 (PFN3)    04147 Exosome [BR:pviv04147]     125170045 (PFN3) Membrane trafficking [BR:pviv04131]  Others   Actin-binding proteins    Others     125170045 (PFN3) Cytoskeleton proteins [BR:pviv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125170045 (PFN3) Exosome [BR:pviv04147]  Exosomal proteins   Proteins found in most exosomes    125170045 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125170045 NCBI-ProteinID:  XP_047722116 LinkDB All DBs Position A1:174021332..174021846 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIMGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELINGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaaaggctatatcagtgcagtgctgcgggaccagcgtattgatgacgtg gccatcatgggccactcagacaatcgctgcgtgtgggcatcgcgccctgggggccttcta gctgccatatcaccgcaggaggtgggtgtgctcacagggcctgatcggcacaccttcctg caggccggcctgagtgtggcaggccgccgctgctgcgtcatccgagaccacctgctgtct gagggagatggtgttctggacgctcgcactaaagggctggatgggcgtgctgtctgcgtg ggccacaccccgcgcgtgctcctggtgctcatgggccgacggggtgtgcatgggggcatc ctcaacaagacagtgcatgagctgatcaatgggctacgcaagcagggcacatag

DBGET integrated database retrieval system