Prionailurus viverrinus (fishing cat): 125170442 Help Entry 125170442         CDS       T09889                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04814   Motor proteins pviv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pviv00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     125170442  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125170442  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pviv03037]     125170442    04812 Cytoskeleton proteins [BR:pviv04812]     125170442 Cilium and associated proteins [BR:pviv03037]  Motile cilia and associated proteins   Dynein arm    125170442 Cytoskeleton proteins [BR:pviv04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      125170442 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  125170442 NCBI-ProteinID:  XP_047723032 LinkDB All DBs Position B4:complement(27785999..27814466) Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctgccgaggagactgcttttgttgttgatgaagtgagcaacatt gtaaaagaggctatagaaagtgcaatcggtggcaacgcctatcagcacagcaaagtgaac cagtggaccacaaacgtagtcgaacagactttaagccaactcaccaagctgggcaagcca tttaaatacatcgtgacctgtgtaattatgcagaagaacggagcagggttacacacggca agttcctgcttctgggacagctctacggacggcagctgcactgtgcggtgggagaacaag accatgtactgcatcgttagcgccttcgggctgtccatctga

DBGET integrated database retrieval system