Prionailurus viverrinus (fishing cat): 125171937 Help Entry 125171937         CDS       T09889                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv01521   EGFR tyrosine kinase inhibitor resistance pviv01522   Endocrine resistance pviv04010   MAPK signaling pathway pviv04012   ErbB signaling pathway pviv04014   Ras signaling pathway pviv04015   Rap1 signaling pathway pviv04062   Chemokine signaling pathway pviv04068   FoxO signaling pathway pviv04071   Sphingolipid signaling pathway pviv04072   Phospholipase D signaling pathway pviv04137   Mitophagy - animal pviv04140   Autophagy - animal pviv04150   mTOR signaling pathway pviv04151   PI3K-Akt signaling pathway pviv04210   Apoptosis pviv04211   Longevity regulating pathway pviv04213   Longevity regulating pathway - multiple species pviv04218   Cellular senescence pviv04360   Axon guidance pviv04370   VEGF signaling pathway pviv04371   Apelin signaling pathway pviv04540   Gap junction pviv04550   Signaling pathways regulating pluripotency of stem cells pviv04625   C-type lectin receptor signaling pathway pviv04650   Natural killer cell mediated cytotoxicity pviv04660   T cell receptor signaling pathway pviv04662   B cell receptor signaling pathway pviv04664   Fc epsilon RI signaling pathway pviv04714   Thermogenesis pviv04720   Long-term potentiation pviv04722   Neurotrophin signaling pathway pviv04725   Cholinergic synapse pviv04726   Serotonergic synapse pviv04730   Long-term depression pviv04810   Regulation of actin cytoskeleton pviv04910   Insulin signaling pathway pviv04912   GnRH signaling pathway pviv04915   Estrogen signaling pathway pviv04916   Melanogenesis pviv04917   Prolactin signaling pathway pviv04919   Thyroid hormone signaling pathway pviv04921   Oxytocin signaling pathway pviv04926   Relaxin signaling pathway pviv04929   GnRH secretion pviv04933   AGE-RAGE signaling pathway in diabetic complications pviv04935   Growth hormone synthesis, secretion and action pviv05010   Alzheimer disease pviv05022   Pathways of neurodegeneration - multiple diseases pviv05034   Alcoholism pviv05160   Hepatitis C pviv05161   Hepatitis B pviv05163   Human cytomegalovirus infection pviv05165   Human papillomavirus infection pviv05166   Human T-cell leukemia virus 1 infection pviv05167   Kaposi sarcoma-associated herpesvirus infection pviv05170   Human immunodeficiency virus 1 infection pviv05200   Pathways in cancer pviv05203   Viral carcinogenesis pviv05205   Proteoglycans in cancer pviv05206   MicroRNAs in cancer pviv05207   Chemical carcinogenesis - receptor activation pviv05208   Chemical carcinogenesis - reactive oxygen species pviv05210   Colorectal cancer pviv05211   Renal cell carcinoma pviv05213   Endometrial cancer pviv05214   Glioma pviv05215   Prostate cancer pviv05216   Thyroid cancer pviv05218   Melanoma pviv05219   Bladder cancer pviv05220   Chronic myeloid leukemia pviv05221   Acute myeloid leukemia pviv05223   Non-small cell lung cancer pviv05224   Breast cancer pviv05225   Hepatocellular carcinoma pviv05226   Gastric cancer pviv05230   Central carbon metabolism in cancer pviv05231   Choline metabolism in cancer pviv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pviv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     125171937 (NRAS)    04015 Rap1 signaling pathway     125171937 (NRAS)    04068 FoxO signaling pathway     125171937 (NRAS)    04072 Phospholipase D signaling pathway     125171937 (NRAS)    04071 Sphingolipid signaling pathway     125171937 (NRAS)    04151 PI3K-Akt signaling pathway     125171937 (NRAS)    04150 mTOR signaling pathway     125171937 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125171937 (NRAS)    04137 Mitophagy - animal     125171937 (NRAS)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     125171937 (NRAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     125171937 (NRAS)    04660 T cell receptor signaling pathway     125171937 (NRAS)    04662 B cell receptor signaling pathway     125171937 (NRAS)    04664 Fc epsilon RI signaling pathway     125171937 (NRAS)    04062 Chemokine signaling pathway     125171937 (NRAS)   09152 Endocrine system    04929 GnRH secretion     125171937 (NRAS)    04915 Estrogen signaling pathway     125171937 (NRAS)    04917 Prolactin signaling pathway     125171937 (NRAS)    04921 Oxytocin signaling pathway     125171937 (NRAS)    04926 Relaxin signaling pathway     125171937 (NRAS)    04935 Growth hormone synthesis, secretion and action     125171937 (NRAS)    04919 Thyroid hormone signaling pathway     125171937 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     125171937 (NRAS)    04726 Serotonergic synapse     125171937 (NRAS)    04720 Long-term potentiation     125171937 (NRAS)    04730 Long-term depression     125171937 (NRAS)    04722 Neurotrophin signaling pathway     125171937 (NRAS)   09158 Development and regeneration    04360 Axon guidance     125171937 (NRAS)   09149 Aging    04211 Longevity regulating pathway     125171937 (NRAS)    04213 Longevity regulating pathway - multiple species     125171937 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     125171937 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125171937 (NRAS)    05206 MicroRNAs in cancer     125171937 (NRAS)    05205 Proteoglycans in cancer     125171937 (NRAS)    05207 Chemical carcinogenesis - receptor activation     125171937 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     125171937 (NRAS)    05203 Viral carcinogenesis     125171937 (NRAS)    05230 Central carbon metabolism in cancer     125171937 (NRAS)    05231 Choline metabolism in cancer     125171937 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125171937 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     125171937 (NRAS)    05225 Hepatocellular carcinoma     125171937 (NRAS)    05226 Gastric cancer     125171937 (NRAS)    05214 Glioma     125171937 (NRAS)    05216 Thyroid cancer     125171937 (NRAS)    05221 Acute myeloid leukemia     125171937 (NRAS)    05220 Chronic myeloid leukemia     125171937 (NRAS)    05218 Melanoma     125171937 (NRAS)    05211 Renal cell carcinoma     125171937 (NRAS)    05219 Bladder cancer     125171937 (NRAS)    05215 Prostate cancer     125171937 (NRAS)    05213 Endometrial cancer     125171937 (NRAS)    05224 Breast cancer     125171937 (NRAS)    05223 Non-small cell lung cancer     125171937 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125171937 (NRAS)    05170 Human immunodeficiency virus 1 infection     125171937 (NRAS)    05161 Hepatitis B     125171937 (NRAS)    05160 Hepatitis C     125171937 (NRAS)    05163 Human cytomegalovirus infection     125171937 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     125171937 (NRAS)    05165 Human papillomavirus infection     125171937 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     125171937 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     125171937 (NRAS)   09165 Substance dependence    05034 Alcoholism     125171937 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125171937 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     125171937 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     125171937 (NRAS)    01522 Endocrine resistance     125171937 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pviv04131]     125171937 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125171937 (NRAS)    04031 GTP-binding proteins [BR:pviv04031]     125171937 (NRAS) Membrane trafficking [BR:pviv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     125171937 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     125171937 (NRAS) Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125171937 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    125171937 (NRAS)   Exosomal proteins of breast cancer cells    125171937 (NRAS)   Exosomal proteins of colorectal cancer cells    125171937 (NRAS) GTP-binding proteins [BR:pviv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     125171937 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  125171937 NCBI-ProteinID:  XP_047725169 LinkDB All DBs Position C1:116148341..116158655 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggaccgtcgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system