KEGG   Prionailurus viverrinus (fishing cat): 125171937
Entry
125171937         CDS       T09889                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
pviv  Prionailurus viverrinus (fishing cat)
Pathway
pviv01521  EGFR tyrosine kinase inhibitor resistance
pviv01522  Endocrine resistance
pviv04010  MAPK signaling pathway
pviv04012  ErbB signaling pathway
pviv04014  Ras signaling pathway
pviv04015  Rap1 signaling pathway
pviv04062  Chemokine signaling pathway
pviv04068  FoxO signaling pathway
pviv04071  Sphingolipid signaling pathway
pviv04072  Phospholipase D signaling pathway
pviv04137  Mitophagy - animal
pviv04140  Autophagy - animal
pviv04150  mTOR signaling pathway
pviv04151  PI3K-Akt signaling pathway
pviv04210  Apoptosis
pviv04211  Longevity regulating pathway
pviv04213  Longevity regulating pathway - multiple species
pviv04218  Cellular senescence
pviv04360  Axon guidance
pviv04370  VEGF signaling pathway
pviv04371  Apelin signaling pathway
pviv04540  Gap junction
pviv04550  Signaling pathways regulating pluripotency of stem cells
pviv04625  C-type lectin receptor signaling pathway
pviv04650  Natural killer cell mediated cytotoxicity
pviv04660  T cell receptor signaling pathway
pviv04662  B cell receptor signaling pathway
pviv04664  Fc epsilon RI signaling pathway
pviv04714  Thermogenesis
pviv04720  Long-term potentiation
pviv04722  Neurotrophin signaling pathway
pviv04725  Cholinergic synapse
pviv04726  Serotonergic synapse
pviv04730  Long-term depression
pviv04810  Regulation of actin cytoskeleton
pviv04910  Insulin signaling pathway
pviv04912  GnRH signaling pathway
pviv04915  Estrogen signaling pathway
pviv04916  Melanogenesis
pviv04917  Prolactin signaling pathway
pviv04919  Thyroid hormone signaling pathway
pviv04921  Oxytocin signaling pathway
pviv04926  Relaxin signaling pathway
pviv04929  GnRH secretion
pviv04933  AGE-RAGE signaling pathway in diabetic complications
pviv04935  Growth hormone synthesis, secretion and action
pviv05010  Alzheimer disease
pviv05022  Pathways of neurodegeneration - multiple diseases
pviv05034  Alcoholism
pviv05160  Hepatitis C
pviv05161  Hepatitis B
pviv05163  Human cytomegalovirus infection
pviv05165  Human papillomavirus infection
pviv05166  Human T-cell leukemia virus 1 infection
pviv05167  Kaposi sarcoma-associated herpesvirus infection
pviv05170  Human immunodeficiency virus 1 infection
pviv05200  Pathways in cancer
pviv05203  Viral carcinogenesis
pviv05205  Proteoglycans in cancer
pviv05206  MicroRNAs in cancer
pviv05207  Chemical carcinogenesis - receptor activation
pviv05208  Chemical carcinogenesis - reactive oxygen species
pviv05210  Colorectal cancer
pviv05211  Renal cell carcinoma
pviv05213  Endometrial cancer
pviv05214  Glioma
pviv05215  Prostate cancer
pviv05216  Thyroid cancer
pviv05218  Melanoma
pviv05219  Bladder cancer
pviv05220  Chronic myeloid leukemia
pviv05221  Acute myeloid leukemia
pviv05223  Non-small cell lung cancer
pviv05224  Breast cancer
pviv05225  Hepatocellular carcinoma
pviv05226  Gastric cancer
pviv05230  Central carbon metabolism in cancer
pviv05231  Choline metabolism in cancer
pviv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pviv05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pviv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    125171937 (NRAS)
   04012 ErbB signaling pathway
    125171937 (NRAS)
   04014 Ras signaling pathway
    125171937 (NRAS)
   04015 Rap1 signaling pathway
    125171937 (NRAS)
   04370 VEGF signaling pathway
    125171937 (NRAS)
   04371 Apelin signaling pathway
    125171937 (NRAS)
   04068 FoxO signaling pathway
    125171937 (NRAS)
   04072 Phospholipase D signaling pathway
    125171937 (NRAS)
   04071 Sphingolipid signaling pathway
    125171937 (NRAS)
   04151 PI3K-Akt signaling pathway
    125171937 (NRAS)
   04150 mTOR signaling pathway
    125171937 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    125171937 (NRAS)
   04137 Mitophagy - animal
    125171937 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    125171937 (NRAS)
   04218 Cellular senescence
    125171937 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    125171937 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    125171937 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    125171937 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    125171937 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    125171937 (NRAS)
   04660 T cell receptor signaling pathway
    125171937 (NRAS)
   04662 B cell receptor signaling pathway
    125171937 (NRAS)
   04664 Fc epsilon RI signaling pathway
    125171937 (NRAS)
   04062 Chemokine signaling pathway
    125171937 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    125171937 (NRAS)
   04929 GnRH secretion
    125171937 (NRAS)
   04912 GnRH signaling pathway
    125171937 (NRAS)
   04915 Estrogen signaling pathway
    125171937 (NRAS)
   04917 Prolactin signaling pathway
    125171937 (NRAS)
   04921 Oxytocin signaling pathway
    125171937 (NRAS)
   04926 Relaxin signaling pathway
    125171937 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    125171937 (NRAS)
   04919 Thyroid hormone signaling pathway
    125171937 (NRAS)
   04916 Melanogenesis
    125171937 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    125171937 (NRAS)
   04726 Serotonergic synapse
    125171937 (NRAS)
   04720 Long-term potentiation
    125171937 (NRAS)
   04730 Long-term depression
    125171937 (NRAS)
   04722 Neurotrophin signaling pathway
    125171937 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    125171937 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    125171937 (NRAS)
   04213 Longevity regulating pathway - multiple species
    125171937 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    125171937 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    125171937 (NRAS)
   05206 MicroRNAs in cancer
    125171937 (NRAS)
   05205 Proteoglycans in cancer
    125171937 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    125171937 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    125171937 (NRAS)
   05203 Viral carcinogenesis
    125171937 (NRAS)
   05230 Central carbon metabolism in cancer
    125171937 (NRAS)
   05231 Choline metabolism in cancer
    125171937 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    125171937 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    125171937 (NRAS)
   05225 Hepatocellular carcinoma
    125171937 (NRAS)
   05226 Gastric cancer
    125171937 (NRAS)
   05214 Glioma
    125171937 (NRAS)
   05216 Thyroid cancer
    125171937 (NRAS)
   05221 Acute myeloid leukemia
    125171937 (NRAS)
   05220 Chronic myeloid leukemia
    125171937 (NRAS)
   05218 Melanoma
    125171937 (NRAS)
   05211 Renal cell carcinoma
    125171937 (NRAS)
   05219 Bladder cancer
    125171937 (NRAS)
   05215 Prostate cancer
    125171937 (NRAS)
   05213 Endometrial cancer
    125171937 (NRAS)
   05224 Breast cancer
    125171937 (NRAS)
   05223 Non-small cell lung cancer
    125171937 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    125171937 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    125171937 (NRAS)
   05161 Hepatitis B
    125171937 (NRAS)
   05160 Hepatitis C
    125171937 (NRAS)
   05163 Human cytomegalovirus infection
    125171937 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    125171937 (NRAS)
   05165 Human papillomavirus infection
    125171937 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125171937 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    125171937 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    125171937 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    125171937 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    125171937 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    125171937 (NRAS)
   01522 Endocrine resistance
    125171937 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pviv04131]
    125171937 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pviv04147]
    125171937 (NRAS)
   04031 GTP-binding proteins [BR:pviv04031]
    125171937 (NRAS)
Membrane trafficking [BR:pviv04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    125171937 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    125171937 (NRAS)
Exosome [BR:pviv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   125171937 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   125171937 (NRAS)
  Exosomal proteins of breast cancer cells
   125171937 (NRAS)
  Exosomal proteins of colorectal cancer cells
   125171937 (NRAS)
GTP-binding proteins [BR:pviv04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    125171937 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 125171937
NCBI-ProteinID: XP_047725169
LinkDB
Position
C1:116148341..116158655
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt
aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggaccgtcgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system