Prionailurus viverrinus (fishing cat): 125173215 Help Entry 125173215         CDS       T09889                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv01522   Endocrine resistance pviv04010   MAPK signaling pathway pviv04012   ErbB signaling pathway pviv04024   cAMP signaling pathway pviv04137   Mitophagy - animal pviv04210   Apoptosis pviv04310   Wnt signaling pathway pviv04380   Osteoclast differentiation pviv04510   Focal adhesion pviv04530   Tight junction pviv04620   Toll-like receptor signaling pathway pviv04621   NOD-like receptor signaling pathway pviv04625   C-type lectin receptor signaling pathway pviv04657   IL-17 signaling pathway pviv04658   Th1 and Th2 cell differentiation pviv04659   Th17 cell differentiation pviv04660   T cell receptor signaling pathway pviv04662   B cell receptor signaling pathway pviv04668   TNF signaling pathway pviv04722   Neurotrophin signaling pathway pviv04912   GnRH signaling pathway pviv04915   Estrogen signaling pathway pviv04921   Oxytocin signaling pathway pviv04926   Relaxin signaling pathway pviv04932   Non-alcoholic fatty liver disease pviv04933   AGE-RAGE signaling pathway in diabetic complications pviv05030   Cocaine addiction pviv05031   Amphetamine addiction pviv05132   Salmonella infection pviv05133   Pertussis pviv05135   Yersinia infection pviv05140   Leishmaniasis pviv05142   Chagas disease pviv05161   Hepatitis B pviv05162   Measles pviv05166   Human T-cell leukemia virus 1 infection pviv05167   Kaposi sarcoma-associated herpesvirus infection pviv05169   Epstein-Barr virus infection pviv05170   Human immunodeficiency virus 1 infection pviv05171   Coronavirus disease - COVID-19 pviv05200   Pathways in cancer pviv05203   Viral carcinogenesis pviv05207   Chemical carcinogenesis - receptor activation pviv05208   Chemical carcinogenesis - reactive oxygen species pviv05210   Colorectal cancer pviv05211   Renal cell carcinoma pviv05224   Breast cancer pviv05231   Choline metabolism in cancer pviv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pviv05321   Inflammatory bowel disease pviv05323   Rheumatoid arthritis pviv05417   Lipid and atherosclerosis pviv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125173215 (JUN)    04012 ErbB signaling pathway     125173215 (JUN)    04310 Wnt signaling pathway     125173215 (JUN)    04668 TNF signaling pathway     125173215 (JUN)    04024 cAMP signaling pathway     125173215 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     125173215 (JUN)   09143 Cell growth and death    04210 Apoptosis     125173215 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     125173215 (JUN)    04530 Tight junction     125173215 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125173215 (JUN)    04621 NOD-like receptor signaling pathway     125173215 (JUN)    04625 C-type lectin receptor signaling pathway     125173215 (JUN)    04660 T cell receptor signaling pathway     125173215 (JUN)    04658 Th1 and Th2 cell differentiation     125173215 (JUN)    04659 Th17 cell differentiation     125173215 (JUN)    04657 IL-17 signaling pathway     125173215 (JUN)    04662 B cell receptor signaling pathway     125173215 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     125173215 (JUN)    04915 Estrogen signaling pathway     125173215 (JUN)    04921 Oxytocin signaling pathway     125173215 (JUN)    04926 Relaxin signaling pathway     125173215 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     125173215 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     125173215 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125173215 (JUN)    05207 Chemical carcinogenesis - receptor activation     125173215 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     125173215 (JUN)    05203 Viral carcinogenesis     125173215 (JUN)    05231 Choline metabolism in cancer     125173215 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125173215 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     125173215 (JUN)    05211 Renal cell carcinoma     125173215 (JUN)    05224 Breast cancer     125173215 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125173215 (JUN)    05170 Human immunodeficiency virus 1 infection     125173215 (JUN)    05161 Hepatitis B     125173215 (JUN)    05171 Coronavirus disease - COVID-19     125173215 (JUN)    05162 Measles     125173215 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     125173215 (JUN)    05169 Epstein-Barr virus infection     125173215 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     125173215 (JUN)    05135 Yersinia infection     125173215 (JUN)    05133 Pertussis     125173215 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     125173215 (JUN)    05142 Chagas disease     125173215 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     125173215 (JUN)    05321 Inflammatory bowel disease     125173215 (JUN)   09165 Substance dependence    05030 Cocaine addiction     125173215 (JUN)    05031 Amphetamine addiction     125173215 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125173215 (JUN)    05418 Fluid shear stress and atherosclerosis     125173215 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     125173215 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     125173215 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     125173215 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pviv03000]     125173215 (JUN) Transcription factors [BR:pviv03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     125173215 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_Maf bZIP_2 Rab11-FIP3 ZapB RIMB1_N MIC19_MIC25 PspA_IM30 Fib_alpha DUF3450 TFIIA FlaC_arch Motif Other DBs NCBI-GeneID:  125173215 NCBI-ProteinID:  XP_047728068 LinkDB All DBs Position C1:166656263..166659009 Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tctgagagcggtgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgct ctgagcagcggcggtggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcaacagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaatatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system