Prionailurus viverrinus (fishing cat): 125174746 Help Entry 125174746         CDS       T09889                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04015   Rap1 signaling pathway pviv04810   Regulation of actin cytoskeleton pviv05014   Amyotrophic lateral sclerosis pviv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125174746 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125174746 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125174746 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125174746 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pviv04131]     125174746 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pviv04812]     125174746 (PFN2)    04147 Exosome [BR:pviv04147]     125174746 (PFN2) Membrane trafficking [BR:pviv04131]  Others   Actin-binding proteins    Others     125174746 (PFN2) Cytoskeleton proteins [BR:pviv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125174746 (PFN2) Exosome [BR:pviv04147]  Exosomal proteins   Proteins found in most exosomes    125174746 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125174746 NCBI-ProteinID:  XP_047730439 LinkDB All DBs Position C2:complement(44637348..44646293) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system