Prionailurus viverrinus (fishing cat): 125174759 Help Entry 125174759         CDS       T09889                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04146   Peroxisome pviv04213   Longevity regulating pathway - multiple species pviv05012   Parkinson disease pviv05014   Amyotrophic lateral sclerosis pviv05016   Huntington disease pviv05020   Prion disease pviv05022   Pathways of neurodegeneration - multiple diseases pviv05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:pviv00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     125174759 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     125174759 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     125174759 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     125174759 (SOD1)    05014 Amyotrophic lateral sclerosis     125174759 (SOD1)    05016 Huntington disease     125174759 (SOD1)    05020 Prion disease     125174759 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     125174759 (SOD1) Enzymes [BR:pviv01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      125174759 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  125174759 NCBI-ProteinID:  XP_047730474 LinkDB All DBs Position C2:146564373..146572962 Genome browser AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGNGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVANVSMEDSLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtggagggcaccatccac ttcgtacagaagggcaatgggcctgttgtggtatcaggaaccattacaggattgactgaa ggagagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagtgca ggccctcactttaatcctctatccaaaaaacatggtgggccaaaagatcaagagaggcat gttggagaccttggcaacgtaactgctggcaaggacggtgtggccaacgtgtctatggaa gattctctgattgcactctcaggagaccattccatcattggccgcacgatggtggtccac gagaaacgagatgacttgggcaaaggtggaaatgaagaaagtacgcaaacgggaaacgct gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system