Prionailurus viverrinus (fishing cat): 125175189 Help Entry 125175189         CDS       T09889                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04060   Cytokine-cytokine receptor interaction pviv04620   Toll-like receptor signaling pathway pviv04622   RIG-I-like receptor signaling pathway pviv04625   C-type lectin receptor signaling pathway pviv04630   JAK-STAT signaling pathway pviv04658   Th1 and Th2 cell differentiation pviv04936   Alcoholic liver disease pviv04940   Type I diabetes mellitus pviv05133   Pertussis pviv05134   Legionellosis pviv05140   Leishmaniasis pviv05142   Chagas disease pviv05143   African trypanosomiasis pviv05144   Malaria pviv05145   Toxoplasmosis pviv05146   Amoebiasis pviv05152   Tuberculosis pviv05162   Measles pviv05164   Influenza A pviv05168   Herpes simplex virus 1 infection pviv05171   Coronavirus disease - COVID-19 pviv05200   Pathways in cancer pviv05321   Inflammatory bowel disease pviv05330   Allograft rejection pviv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pviv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125175189 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125175189 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125175189 (IL12A)    04622 RIG-I-like receptor signaling pathway     125175189 (IL12A)    04625 C-type lectin receptor signaling pathway     125175189 (IL12A)    04658 Th1 and Th2 cell differentiation     125175189 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125175189 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     125175189 (IL12A)    05164 Influenza A     125175189 (IL12A)    05162 Measles     125175189 (IL12A)    05168 Herpes simplex virus 1 infection     125175189 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     125175189 (IL12A)    05134 Legionellosis     125175189 (IL12A)    05152 Tuberculosis     125175189 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     125175189 (IL12A)    05144 Malaria     125175189 (IL12A)    05145 Toxoplasmosis     125175189 (IL12A)    05140 Leishmaniasis     125175189 (IL12A)    05142 Chagas disease     125175189 (IL12A)    05143 African trypanosomiasis     125175189 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     125175189 (IL12A)    05330 Allograft rejection     125175189 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125175189 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     125175189 (IL12A)    04936 Alcoholic liver disease     125175189 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pviv04052]     125175189 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:pviv00536]     125175189 (IL12A) Cytokines and neuropeptides [BR:pviv04052]  Cytokines   Interleukins    125175189 (IL12A) Glycosaminoglycan binding proteins [BR:pviv00536]  Heparan sulfate / Heparin   Cytokines    125175189 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 DUF5952 Motif Other DBs NCBI-GeneID:  125175189 NCBI-ProteinID:  XP_047731495 LinkDB All DBs Position C2:54047390..54055092 Genome browser AA seq 222 aa AA seqDB search MCPPRGLLLVTILVLLNHLDHLSLARNLPTPTSSPGMFQCLNHSQTLLRAISNTLQKARQ TLEFYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKTS FMTTLCLSSIYEDLKMYQVEFKAINAKLLMDPKRQIFLDQNMLTAIDELLQALNVNSVTV PQNSSLEEPDFYKTKIKLCILLHAFRIRAVTINRMMSYLNSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgccgcgtggcctcctccttgtaaccatcctggtcctgttaaaccacctggac cacctcagtttggccaggaacctccccacacccacctcaagcccaggaatgttccagtgc ctcaaccactcccaaaccctgctgcgagccatcagcaacacgcttcagaaggccagacaa actctagaattttactcctgcacttccgaagagattgatcatgaagatatcacaaaagat aaaaccagcacagtggaggcctgcttaccactggaattaaccatgaatgagagttgcctg gcttccagagagatctctctgataactaatgggagttgcctggcctccagaaagacctct tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag ttcaaggccattaatgcaaagctgttaatggatcctaaaaggcagatctttctggatcaa aacatgctgacagctattgatgagctgttacaggccctgaatgtcaacagtgtgactgtg ccacagaactcctctctggaagaaccggatttttataaaactaaaatcaagctctgcata cttcttcatgctttcagaattcgtgcagtgaccatcaatagaatgatgagctatctgaat tcttcctaa

DBGET integrated database retrieval system