Prionailurus viverrinus (fishing cat): 125176244 Help Entry 125176244         CDS       T09889                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism pviv  Prionailurus viverrinus (fishing cat) Pathway pviv04610   Complement and coagulation cascades pviv04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:pviv00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125176244 (CD59)    04610 Complement and coagulation cascades     125176244 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pviv04147]     125176244 (CD59)    04090 CD molecules [BR:pviv04090]     125176244 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pviv00537]     125176244 (CD59) Exosome [BR:pviv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125176244 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    125176244 (CD59)   Exosomal proteins of colorectal cancer cells    125176244 (CD59) CD molecules [BR:pviv04090]  Proteins   125176244 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pviv00537]  Antigens   125176244 (CD59) SSDB OrthologParalogGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Activin_recp Motif Other DBs NCBI-GeneID:  125176244 NCBI-ProteinID:  XP_047733312 LinkDB All DBs Position D1:complement(88052074..88073192) Genome browser AA seq 126 aa AA seqDB search MITMGSQGFILLVLLLILAVLCHSGHSLTCYSCVSPVSGNCTKTTVCSSNFDSCLYIEAE PKSYYYQCWKLADCSFERISASLGLQKLQYRCCQQDLCNRSFGTTVSGTMALLVTPLLAA AWNLCL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgatcacgatgggaagccaaggattcatcctgctggtgctcctgctcatcctggctgtc ctctgccattcaggtcatagcctgacatgctacagctgtgtgtcaccagtgagtggtaac tgcactaagaccaccgtttgttcatcgaattttgactcgtgtctctacattgaagccgag cccaaatcctattactaccagtgctggaagttggcggactgcagtttcgagcgcatctca gcttccttggggcttcagaagctccagtaccgctgctgccagcaggacctgtgtaacagg agctttggcaccactgtctccgggacgatggctctgctggtgaccccgctgctggcagca gcctggaacctttgtctctaa

DBGET integrated database retrieval system