Pseudomonas viciae: EPZ47_28495 Help Entry EPZ47_28495       CDS       T07167                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pvk  Pseudomonas viciae Brite KEGG Orthology (KO) [BR:pvk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvk03036]     EPZ47_28495 Chromosome and associated proteins [BR:pvk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     EPZ47_28495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament Asd-4 ZapB VGPC1_C Macoilin TPR_MLP1_2 Motif Other DBs NCBI-ProteinID:  QBZ92464 UniProt:  A0A4V1CBH9 LinkDB All DBs Position 6376379..6376588 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLIDRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaattgctaattgaccgggtc gagcaacttaagagccaaaacggactcctattagctcaggaaaagacctggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system