Proteus mirabilis CYPV1: AOB99_01270 Help Entry AOB99_01270       CDS       T04093                                  Symbol hfq Name (GenBank) RNA-binding protein   KO K03666   host factor-I protein Organism pvl  Proteus mirabilis CYPV1 Pathway pvl02024   Quorum sensing pvl03018   RNA degradation Brite KEGG Orthology (KO) [BR:pvl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AOB99_01270 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AOB99_01270 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pvl03019]     AOB99_01270 (hfq)    03036 Chromosome and associated proteins [BR:pvl03036]     AOB99_01270 (hfq) Messenger RNA biogenesis [BR:pvl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AOB99_01270 (hfq) Chromosome and associated proteins [BR:pvl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AOB99_01270 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 6TM_1st_PGAP2IP Motif Other DBs NCBI-ProteinID:  ALE24112 UniProt:  A0A1Z1SPU1 LinkDB All DBs Position 248470..248760 Genome browser AA seq 96 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNTGTNQAGTNYSGGNATQQDDVAE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccttttctgaacgcattacgtcgtgaaagggtc cctgtttcaatctatttggtaaacggcattaaattacagggtcagatcgaatcttttgac caatttgttattctgctgaaaaacactgttagtcagatggtatacaaacatgctatctct accgtagtaccttctcgtcctgtttctcatcatagcaatacaggtaccaaccaagcgggt acaaactacagtggcggtaacgcgactcagcaggatgatgttgcagaataa

DBGET integrated database retrieval system