Penaeus vannamei (Pacific white shrimp): 113805842 Help Entry 113805842         CDS       T06111                                  Symbol Cdc42 Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism pvm  Penaeus vannamei (Pacific white shrimp) Pathway pvm04144   Endocytosis pvm04517   IgSF CAM signaling pvm04518   Integrin signaling pvm05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pvm00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113805842 (Cdc42)    04518 Integrin signaling     113805842 (Cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113805842 (Cdc42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113805842 (Cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvm04131]     113805842 (Cdc42)    03036 Chromosome and associated proteins [BR:pvm03036]     113805842 (Cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvm04147]     113805842 (Cdc42)    04031 GTP-binding proteins [BR:pvm04031]     113805842 (Cdc42) Membrane trafficking [BR:pvm04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113805842 (Cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     113805842 (Cdc42)   Macropinocytosis    Ras GTPases     113805842 (Cdc42) Chromosome and associated proteins [BR:pvm03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     113805842 (Cdc42) Exosome [BR:pvm04147]  Exosomal proteins   Exosomal proteins of microglial cells    113805842 (Cdc42)   Exosomal proteins of breast milk    113805842 (Cdc42) GTP-binding proteins [BR:pvm04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113805842 (Cdc42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  113805842 NCBI-ProteinID:  XP_027212701 LinkDB All DBs Position 29:complement(31090944..31119339) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DDAATVEKLAKNKQKPITYEQGDKLSRELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPQRRRKCIVL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccattaaatgcgtagtggtgggcgatggagcggtgggtaagacctgcctcctc atctcctacacgacaaacaagttcccttcagaatacgttcccacagtatttgacaactat gctgtgactgttatgataggaggggagccatacacattaggcctttttgatacagctggt caggaggattatgacagactgcgacctcttagctatccacagacagatgttttcttagtc tgcttctcagtggtatccccttcatcctttgagaatgtcaaagaaaagtgggtaccagaa atcactcaccactgccagaagacgccattcctcctagtaggcacacagatagatttgcgg gatgatgcagcaacagtagaaaagttggcaaagaataagcagaagccaatcacctacgaa caaggggacaagctcagtcgcgagctgaaggccgtcaagtacgtggaatgctccgcgctc acacagaaggggctgaagaacgtatttgatgaagcaattctcgcagccctggagccccca gaacctcagagacgaaggaaatgtattgttctgtag

DBGET integrated database retrieval system