Penaeus vannamei (Pacific white shrimp): 113807654 Help Entry 113807654         CDS       T06111                                  Symbol Dlc90F Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism pvm  Penaeus vannamei (Pacific white shrimp) Pathway pvm04814   Motor proteins Brite KEGG Orthology (KO) [BR:pvm00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     113807654 (Dlc90F)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvm03037]     113807654 (Dlc90F)    04812 Cytoskeleton proteins [BR:pvm04812]     113807654 (Dlc90F) Cilium and associated proteins [BR:pvm03037]  Motile cilia and associated proteins   Dynein arm    113807654 (Dlc90F) Cytoskeleton proteins [BR:pvm04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      113807654 (Dlc90F) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 RE_TdeIII Motif Other DBs NCBI-GeneID:  113807654 NCBI-ProteinID:  XP_027214759 LinkDB All DBs Position 39:9632785..9638881 Genome browser AA seq 113 aa AA seqDB search MDDNTQNEEHQFVVDEVSTIIKESIETVIGGNAYTSAKVNNWTSQVVENVLGNLSKLNKA FKYIVTCVIMQKNGAGLHTASSCYWDNTTDGSCTVRWENKTMYCIVSVFGLAL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgataacacacagaacgaagagcaccagtttgttgtggatgaggtgagcacaatc atcaaagaaagcatagaaaccgtaataggtggaaatgcatacacaagcgccaaagttaat aattggacgtcgcaggtggtggaaaatgtcctcggaaacctttcgaaactcaacaaggcc ttcaaatatattgtgacgtgcgtcatcatgcagaagaatggggcagggctacacacggcc agctcgtgctactgggacaacaccactgacggctcatgcactgttcgctgggaaaacaaa acgatgtattgcattgtctccgtctttgggttggccctctga

DBGET integrated database retrieval system