Penaeus vannamei (Pacific white shrimp): 113815498 Help Entry 113815498         CDS       T06111                                  Symbol Rab7 Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pvm  Penaeus vannamei (Pacific white shrimp) Pathway pvm04137   Mitophagy - animal pvm04140   Autophagy - animal pvm04144   Endocytosis pvm04145   Phagosome pvm04148   Efferocytosis Brite KEGG Orthology (KO) [BR:pvm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113815498 (Rab7)    04145 Phagosome     113815498 (Rab7)    04140 Autophagy - animal     113815498 (Rab7)    04137 Mitophagy - animal     113815498 (Rab7)    04148 Efferocytosis     113815498 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvm04131]     113815498 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvm04147]     113815498 (Rab7)    04031 GTP-binding proteins [BR:pvm04031]     113815498 (Rab7) Membrane trafficking [BR:pvm04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113815498 (Rab7) Exosome [BR:pvm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113815498 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    113815498 (Rab7)   Exosomal proteins of colorectal cancer cells    113815498 (Rab7)   Exosomal proteins of bladder cancer cells    113815498 (Rab7) GTP-binding proteins [BR:pvm04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113815498 (Rab7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_16 NTPase_1 AAA_24 NACHT AAA_22 AAA_7 ATPase_2 G-alpha AAA_5 ABC_tran SRPRB AAA_14 PRK NB-ARC ATP-synt_ab RNA_helicase TniB Motif Other DBs NCBI-GeneID:  113815498 NCBI-ProteinID:  XP_069981544 UniProt:  D2DW56 LinkDB All DBs Position 9:20760697..20779949 Genome browser AA seq 205 aa AA seqDB search MASRKKILLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNTFKSLDSWRDEFLIQASPRDPDHFPF VVLGNKIDLENRAVSTKRAQQWCHSKNEVPYFETSAKEAINVELAFQTIARNALAQESEV ELYNEFPDQIKLTNDNKAKQDACSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcatctcgcaagaagattctcctgaaggtgatcatccttggagactcaggtgtaggc aaaacatcccttatgaaccagtttgttaacaagaaattcagcaaccagtataaggcaacc attggagcagatttcctcacaaaggaggtcatggttgatgacagattggttacaatgcag atctgggatacagctggtcaagaaagatttcaatcgttaggtgttgcattctatcgagga gctgattgttgtgttctcgtctatgatgttacatctcccaataccttcaagtctctcgat tcatggcgtgacgagtttctaattcaagcctcaccaagggaccctgaccacttcccattt gttgtcctgggtaacaagattgatctggagaatagggcggtatcgacgaagcgagcacaa caatggtgtcatagtaaaaatgaagttccctactttgaaactagtgcaaaggaagctatt aatgtggagctagctttccagaccattgctcgcaatgctcttgctcaggagtcagaggtg gagctgtacaatgagtttccagaccagatcaaattgaccaatgacaacaaggctaaacag gatgcatgctcttgctaa

DBGET integrated database retrieval system