Penaeus vannamei (Pacific white shrimp): 113822446 Help Entry 113822446         CDS       T06111                                  Name (RefSeq) uncharacterized protein   KO K07937   ADP-ribosylation factor 1/2 Organism pvm  Penaeus vannamei (Pacific white shrimp) Pathway pvm04144   Endocytosis Brite KEGG Orthology (KO) [BR:pvm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113822446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvm04131]     113822446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvm04147]     113822446    04031 GTP-binding proteins [BR:pvm04031]     113822446 Membrane trafficking [BR:pvm04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     113822446   Arf GTPases and associated proteins    Arf GTPases     113822446  Endosome - Golgi transport     113822446 Exosome [BR:pvm04147]  Exosomal proteins   Proteins found in most exosomes    113822446 GTP-binding proteins [BR:pvm04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     113822446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Ras Roc G-alpha SRPRB Gtr1_RagA MMR_HSR1 DSBA GTP_EFTU FLAD1_M Vmethyltransf RXYLT1_N DUF4743 Motif Other DBs NCBI-GeneID:  113822446 NCBI-ProteinID:  XP_069971893 LinkDB All DBs Position 38:complement(26183250..26184416) Genome browser AA seq 141 aa AA seqDB search MQLHLHYTNPPPPGFNVETVEYKNISFTVWDVGGQVKLRPLWRHYYQNTAAVVYVVDSSD AERLQEAREELDAILESHEVAGVPLLVVANKQDLPGALSVPQLSEGLDLRRHDRPWHVQP TCAITSEGVYEALDWLARELA NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgcaattgcacttgcattacaccaaccccccccccccaggcttcaacgtggagaccgtc gagtacaagaacatcagcttcaccgtctgggacgtgggcggccaggtcaagctgcgccct ctgtggaggcactactaccagaacaccgccgccgtcgtctacgtggtggacagcagcgac gccgagaggctgcaggaggccagggaggagctggacgccatcctggagagccatgaggtg gcgggggttcccctgctggtggtggccaacaagcaggaccttcccggggcgctgtccgtg ccccagctgagcgagggcctcgacctgcggcgccacgacaggccctggcacgtgcagccc acgtgcgccatcacgtcggagggcgtgtacgaggccctggactggctggccagggagctg gcctag

DBGET integrated database retrieval system