Penaeus vannamei (Pacific white shrimp): 113826383 Help Entry 113826383         CDS       T06111                                  Symbol Josd Name (RefSeq) josephin-like protein   KO K15235   josephin [EC:3.4.19.12] Organism pvm  Penaeus vannamei (Pacific white shrimp) Brite KEGG Orthology (KO) [BR:pvm00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pvm01002]     113826383 (Josd)   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvm04121]     113826383 (Josd) Enzymes [BR:pvm01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.19  Omega peptidases     3.4.19.12  ubiquitinyl hydrolase 1      113826383 (Josd) Peptidases and inhibitors [BR:pvm01002]  Cysteine peptidases   Family C86    113826383 (Josd) Ubiquitin system [BR:pvm04121]  Deubiquitinating enzyme (DUB)   Ubiquitin-specific proteases (UBPs)    MJD     113826383 (Josd) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Josephin Motif Other DBs NCBI-GeneID:  113826383 NCBI-ProteinID:  XP_069975377 LinkDB All DBs Position 44:complement(4507198..4539157) Genome browser AA seq 110 aa AA seqDB search MTEGCSSCISHCFLEIIGCEENQVGVVMTPDIYHEKQIKELCALHSLNNLFQDGGAFAKS ELDNICYALSPDNWFNPHKSLLGTGNYDINVIMAALVTKGCGIEWFDKRK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgacggaggggtgttcttcctgcatctctcattgcttcctagaaataattggatgtgaa gaaaatcaagttggtgttgtcatgaccccagatatttatcatgaaaaacagatcaaagag ctatgtgctcttcattccttgaacaacctatttcaagatggaggagcatttgcaaaaagt gaacttgacaacatatgctatgcattatccccagacaattggtttaatccacacaaatct ctccttggcactgggaactatgacattaatgttattatggcagccttggtcacaaagggt tgtggcattgagtggtttgataagaggaagtaa

DBGET integrated database retrieval system