Paenibacillus vortex: PVOR_11399 Help Entry PVOR_11399        CDS       T05385                                  Name (GenBank) hypothetical protein   KO K09772   cell division inhibitor SepF Organism pvo  Paenibacillus vortex Brite KEGG Orthology (KO) [BR:pvo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvo03036]     PVOR_11399 Chromosome and associated proteins [BR:pvo03036]  Prokaryotic type   Chromosome partitioning proteins    Inhibitors of FtsZ assembly     PVOR_11399 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SepF Abi_C Motif Other DBs NCBI-ProteinID:  EFU42120 UniProt:  A0A2R9SXV3 LinkDB All DBs Position 302795..303058 AA seq 87 aa AA seqDB search MEPRSYDEAQEIADHLRSFRTVVVNLQRVRNDQALRIIDFLSGTVYALSGGISKVGGNIF LCTPDTVEIQGSISEILADEHEYNRMR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtggagccgcgttcatatgatgaagcacaggagattgcagatcatctgcgctcattccga acggttgtcgttaatctgcagcgcgtacgcaatgatcaggcgctgcgcattatcgatttt ctcagcggaacggtatatgcgcttagtggcggaatctccaaggtaggcgggaatatcttc ctatgcacaccggataccgtcgaaattcaaggttccatctccgagattttagcagacgag catgaatataacagaatgaggtga

DBGET integrated database retrieval system