Pteropus vampyrus (large flying fox): 105289768 Help Entry 105289768         CDS       T07815                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04015   Rap1 signaling pathway pvp04810   Regulation of actin cytoskeleton pvp05014   Amyotrophic lateral sclerosis pvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105289768 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105289768 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105289768 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105289768 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105289768 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pvp04812]     105289768 (PFN4)    04147 Exosome [BR:pvp04147]     105289768 (PFN4) Membrane trafficking [BR:pvp04131]  Others   Actin-binding proteins    Others     105289768 (PFN4) Cytoskeleton proteins [BR:pvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105289768 (PFN4) Exosome [BR:pvp04147]  Exosomal proteins   Proteins found in most exosomes    105289768 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105289768 NCBI-ProteinID:  XP_011354866 UniProt:  A0A6P3PW40 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDSLLGTKHVDSAALIKLQERSLCIASPGFSVMPSDVRTLVNGFAKNPLRAR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLHLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactattagattcgctcctgggaacgaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctgtgtatagcatcaccaggatttagtgta atgcccagtgatgttcggacacttgtgaatggatttgccaagaaccctttgcgagccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggctgatgattattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctccaccttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagaagctg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system