Pteropus vampyrus (large flying fox): 105290897 Help Entry 105290897         CDS       T07815                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04068   FoxO signaling pathway pvp04136   Autophagy - other pvp04140   Autophagy - animal pvp04621   NOD-like receptor signaling pathway pvp04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     105290897 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105290897 (ATG12)    04136 Autophagy - other     105290897 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105290897 (ATG12)    04622 RIG-I-like receptor signaling pathway     105290897 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105290897 (ATG12)    04121 Ubiquitin system [BR:pvp04121]     105290897 (ATG12)    03029 Mitochondrial biogenesis [BR:pvp03029]     105290897 (ATG12) Membrane trafficking [BR:pvp04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     105290897 (ATG12) Ubiquitin system [BR:pvp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    105290897 (ATG12) Mitochondrial biogenesis [BR:pvp03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     105290897 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  105290897 NCBI-ProteinID:  XP_023385325 UniProt:  A0A6P6CE17 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MAEEPESVLHLPPSTAADGEGPTESSPGTATPEPPSSAAVSPGTEEPAGDTKKKIYLCKS VLCSFSRPGSWNSL NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggctgaggagccggagtctgtcctgcacctcccgccctcaactgcggctgacggcgaa ggacctacggagagctccccaggaacagccactccagagcccccttcttccgctgcagtc tccccgggaactgaggaacctgctggcgacaccaagaaaaagatttatttatgtaaatca gtcctttgctccttctcccgaccaggaagttggaactctctatga

DBGET integrated database retrieval system