Pteropus vampyrus (large flying fox): 105291298 Help Entry 105291298         CDS       T07815                                  Symbol UBB Name (RefSeq) polyubiquitin-B   KO K04551   ubiquitin B Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04120   Ubiquitin mediated proteolysis pvp04137   Mitophagy - animal pvp04140   Autophagy - animal pvp05012   Parkinson disease pvp05022   Pathways of neurodegeneration - multiple diseases pvp05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:pvp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105291298 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105291298 (UBB)    04137 Mitophagy - animal     105291298 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     105291298 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     105291298 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     105291298 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pvp04121]     105291298 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105291298 (UBB) Ubiquitin system [BR:pvp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    105291298 (UBB) Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of breast milk    105291298 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    105291298 (UBB)   Exosomal proteins of colorectal cancer cells    105291298 (UBB)   Exosomal proteins of bladder cancer cells    105291298 (UBB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N UBL_UBAC1 HATPase_c Motif Other DBs NCBI-GeneID:  105291298 NCBI-ProteinID:  XP_011357298 UniProt:  A0A6P6CEB2 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcttcgtgaagaccctgaccggcaagaccatcaccctggaggtggagccaagt gacaccattgagaatgtgaaggccaagatccaggataaggaaggtatcccccctgaccag cagaggctcatctttgcaggcaagcagctggaagatggccgcactctttctgattacaac attcagaaagagtcgaccctgcatctggtctttcgtctgaggggtggtatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaagtggaacccagtgacaccattgag aatgtgaaggccaagatccaggataaggaaggcatccccccagaccagcagaggctcatc tttgcaggcaagcagctggaagatggccgcactctttctgattacaacattcagaaagag tcgaccctgcacctggtcctacgtctgaggggtggctgttaa

DBGET integrated database retrieval system