Pteropus vampyrus (large flying fox): 105291893 Help Entry 105291893         CDS       T07815                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05202   Transcriptional misregulation in cancer pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105291893  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105291893   09163 Immune disease    05322 Systemic lupus erythematosus     105291893   09165 Substance dependence    05034 Alcoholism     105291893  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105291893   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105291893 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105291893 Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105291893 SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C Motif Other DBs NCBI-GeneID:  105291893 NCBI-ProteinID:  XP_011358233 UniProt:  A0A6P3QD05 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MADTKPTASNSTRGKALRKQLATKAPSKSAPSTGEVKKPYCYRPSTVALCEVRRYQKSTE LIRKLSFQHLVREIAQDVKTDLCFQNAAIGALQESSEAYLVGLFEDTNLCDIHAKRVTIM PKGIYLAHRIHGKHA NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggctgatacaaagccaactgccagcaattccacccgtggtaaagcactgaggaagcaa ctggctacaaaagcccctagcaagagtgcgccctcgactggagaagtaaagaaaccttat tgttacaggcctagtaccgtagcactatgtgaagttagacgttatcagaaatccactgaa ctgattcgcaaactttccttccagcacctggtgcgagaaattgctcaagacgtcaaaaca gatctgtgcttccagaatgcagctattggtgctttgcaggagtcaagtgaagcctatctg gttggcctttttgaagacaccaacctgtgtgatatccatgccaagcgtgtaactattatg ccaaaaggcatttacttagcacaccgcatacatggaaaacatgcttaa

DBGET integrated database retrieval system