Pteropus vampyrus (large flying fox): 105293361 Help Entry 105293361         CDS       T07815                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05202   Transcriptional misregulation in cancer pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105293361  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105293361   09163 Immune disease    05322 Systemic lupus erythematosus     105293361   09165 Substance dependence    05034 Alcoholism     105293361  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105293361   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105293361 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105293361 Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105293361 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  105293361 NCBI-ProteinID:  XP_011360255 UniProt:  A0A6P3QJT3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaaatccacgggtgggaaagcgccccgcaaacag ctggccactaaggctgccaggaaaagcgctccctctaccggcggggtgaaaaaacctcat cgctacaggcccgggaccgttgcgcttcgagaaatccgtcgttaccagaaatcgaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa acggacctgaggttccagagtgctgccatcggcgctcttcaggaggctagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagatatccagttggctcgccggatacggggggagagagcttaa

DBGET integrated database retrieval system