Pteropus vampyrus (large flying fox): 105293508 Help Entry 105293508         CDS       T07815                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04015   Rap1 signaling pathway pvp04810   Regulation of actin cytoskeleton pvp05014   Amyotrophic lateral sclerosis pvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105293508 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105293508 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105293508 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105293508 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105293508 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pvp04812]     105293508 (PFN3)    04147 Exosome [BR:pvp04147]     105293508 (PFN3) Membrane trafficking [BR:pvp04131]  Others   Actin-binding proteins    Others     105293508 (PFN3) Cytoskeleton proteins [BR:pvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105293508 (PFN3) Exosome [BR:pvp04147]  Exosomal proteins   Proteins found in most exosomes    105293508 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105293508 NCBI-ProteinID:  XP_011360505 UniProt:  A0A6P3Q7U3 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MSEWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGMDRCTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTVHELIRGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagtgagtggaaaggctacatcagtgctgtgctgcgggatcagcgtatcgacgacgtg gcgattgtgggccactcggacaatcgctgcgtgtgggcgtcgcggcccgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcacgggaatggaccgatgcaccttcctg caggcgggcctaagcgtagcaggccgccgctgctgcgtcatccgagaccacctgctggct gaaggcgacggagtgctggatgcgcgcaccaaggggttggatgggcgcgccgtctgcgtg ggccacacgccgcgcgcactcctcgtgctcatgggccgacggggcgtgcacgggggcatc ctcaacaagacggtgcacgagctgatccgcgggctgcgcactcagggcacttag

DBGET integrated database retrieval system