Pteropus vampyrus (large flying fox): 105293547 Help Entry 105293547         CDS       T07815                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04060   Cytokine-cytokine receptor interaction pvp04630   JAK-STAT signaling pathway pvp04640   Hematopoietic cell lineage pvp04657   IL-17 signaling pathway pvp04658   Th1 and Th2 cell differentiation pvp04660   T cell receptor signaling pathway pvp04664   Fc epsilon RI signaling pathway pvp04672   Intestinal immune network for IgA production pvp05200   Pathways in cancer pvp05310   Asthma pvp05320   Autoimmune thyroid disease pvp05321   Inflammatory bowel disease pvp05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105293547 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105293547 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105293547 (IL5)    04660 T cell receptor signaling pathway     105293547 (IL5)    04658 Th1 and Th2 cell differentiation     105293547 (IL5)    04657 IL-17 signaling pathway     105293547 (IL5)    04664 Fc epsilon RI signaling pathway     105293547 (IL5)    04672 Intestinal immune network for IgA production     105293547 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105293547 (IL5)   09163 Immune disease    05310 Asthma     105293547 (IL5)    05320 Autoimmune thyroid disease     105293547 (IL5)    05321 Inflammatory bowel disease     105293547 (IL5)    05330 Allograft rejection     105293547 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvp04052]     105293547 (IL5)    00536 Glycosaminoglycan binding proteins [BR:pvp00536]     105293547 (IL5) Cytokines and neuropeptides [BR:pvp04052]  Cytokines   Interleukins    105293547 (IL5) Glycosaminoglycan binding proteins [BR:pvp00536]  Heparan sulfate / Heparin   Cytokines    105293547 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  105293547 NCBI-ProteinID:  XP_023387672 UniProt:  A0A6P6CJQ5 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MMQSPCWGLGRHRQANLMIPTPEHKNHQLCIEEVFQGIDTLKNQTAQGDAVEKLFQNLSL IKKYIDSQKKKCEGERWRVKKFLDYLQVFLGVINTEWTMES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgatgcagtctccttgttgggggctcggacggcaccgacaggcaaacctgatgattcct actcctgaacataaaaatcaccagttatgcattgaagaagtctttcaggggatagacaca ctgaagaatcaaactgcgcaaggggatgccgtggaaaaactattccaaaacttgtcttta ataaaaaaatacatagacagccaaaaaaaaaagtgtgaaggagaacgatggagagtaaaa aaattcctagactacctgcaagtgtttcttggtgtaataaacactgaatggacaatggaa agttga

DBGET integrated database retrieval system