Pteropus vampyrus (large flying fox): 105294382 Help Entry 105294382         CDS       T07815                                  Symbol CENPS Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pvp00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     105294382 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105294382 (CENPS)    03400 DNA repair and recombination proteins [BR:pvp03400]     105294382 (CENPS) Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      105294382 (CENPS) DNA repair and recombination proteins [BR:pvp03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      105294382 (CENPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Bromo_TP Motif Other DBs NCBI-GeneID:  105294382 NCBI-ProteinID:  XP_023388429 UniProt:  A0A6P6CM99 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search FSLQRLKAAVHYTVGCLCEEVASDKEVQFSKQTIAAISEVTFRQCENFAKDLEMFARHAK RSTINTEDVKLLARRSNSLLRYITEKNEEIAQFNLDRKAKKKKKLEDENKNSVEPAEESE S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt ttttcgcttcagaggctgaaggcagcggtccactacactgtgggctgtctttgcgaggag gtggcctcagacaaggaggtgcagttcagcaaacagaccatcgccgcgatctcggaggtg accttccgacagtgtgaaaattttgccaaagacctcgaaatgtttgcaagacacgcgaaa agaagcacaattaataccgaagatgtgaagctcttagccaggaggagtaattcactgcta agatacatcacagagaaaaatgaagagatcgctcagtttaacctggaccgaaaagcaaag aagaaaaagaagttagaggatgaaaacaaaaattcagtggagccagcagaggaaagtgag agttaa

DBGET integrated database retrieval system