Pteropus vampyrus (large flying fox): 105295320 Help Entry 105295320         CDS       T07815                                  Name (RefSeq) thioredoxin isoform X3   KO K03671   thioredoxin Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04621   NOD-like receptor signaling pathway pvp05012   Parkinson disease pvp05132   Salmonella infection pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105295320  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105295320   09164 Neurodegenerative disease    05012 Parkinson disease     105295320   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105295320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pvp03110]     105295320 Chaperones and folding catalysts [BR:pvp03110]  Protein folding catalysts   Protein disulfide isomerase    105295320 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_9 AhpC-TSA Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  105295320 NCBI-ProteinID:  XP_011363234 UniProt:  A0A6P3QN60 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIDSKDAFEEALTSAGSKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKNGKKVGEFSGANKEKLESTINEFI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgacagcaaggatgcttttgaggaagccttgaccagtgcaggaagt aaactcgttgtagttgacttctcagccacatggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtattccaacgtggtgttccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaatggaaaaaaggtgggtgaattttctggagctaataaggaaaaacttgaatccacc atcaatgaattcatctaa

DBGET integrated database retrieval system