Pteropus vampyrus (large flying fox): 105295630 Help Entry 105295630         CDS       T07815                                  Symbol TEX12 Name (RefSeq) testis-expressed protein 12   KO K19537   testis-expressed protein 12 Organism pvp  Pteropus vampyrus (large flying fox) Brite KEGG Orthology (KO) [BR:pvp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105295630 (TEX12)   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvp03037]     105295630 (TEX12) Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Meiosis-specific proteins    Synaptonemal complex     105295630 (TEX12) Cilium and associated proteins [BR:pvp03037]  Motile cilia and associated proteins   Sperm associated proteins    105295630 (TEX12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TEX12 Mer2 Motif Other DBs NCBI-GeneID:  105295630 NCBI-ProteinID:  XP_011363694 UniProt:  A0A6P3QEM0 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MMANHLIKPDTRNYKRPRELEPQMPDSPQVSSLGKSDSSFSESSVLFYKDEALGKDLNDM SKEITLMLSTYAKILSERAAVDASYIDEIDGLFKEANTIENFLIQKRELLKQRFTVIANT LHR NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgatggcaaatcaccttataaaacctgatactagaaattacaagagaccaagagagttg gagcctcaaatgccagatagtccacaagtgtcctctcttggaaaatcagattcctctttc tctgaaagctctgtgctattttataaagatgaagccctggggaaagatttgaatgatatg agcaaggaaattactcttatgttgtctacatatgcaaagatcttaagtgagagagcagca gtggatgcatcttatattgatgagattgatggactcttcaaagaagccaatacaattgaa aactttctaatacaaaaaagagagcttctgaaacagaggtttacagtgattgcaaacaca ctgcacagataa

DBGET integrated database retrieval system