Pteropus vampyrus (large flying fox): 105295781 Help Entry 105295781         CDS       T07815                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04010   MAPK signaling pathway pvp04020   Calcium signaling pathway pvp04022   cGMP-PKG signaling pathway pvp04114   Oocyte meiosis pvp04218   Cellular senescence pvp04310   Wnt signaling pathway pvp04360   Axon guidance pvp04370   VEGF signaling pathway pvp04380   Osteoclast differentiation pvp04625   C-type lectin receptor signaling pathway pvp04650   Natural killer cell mediated cytotoxicity pvp04658   Th1 and Th2 cell differentiation pvp04659   Th17 cell differentiation pvp04660   T cell receptor signaling pathway pvp04662   B cell receptor signaling pathway pvp04720   Long-term potentiation pvp04724   Glutamatergic synapse pvp04921   Oxytocin signaling pathway pvp04922   Glucagon signaling pathway pvp04924   Renin secretion pvp05010   Alzheimer disease pvp05014   Amyotrophic lateral sclerosis pvp05020   Prion disease pvp05022   Pathways of neurodegeneration - multiple diseases pvp05031   Amphetamine addiction pvp05152   Tuberculosis pvp05163   Human cytomegalovirus infection pvp05166   Human T-cell leukemia virus 1 infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05170   Human immunodeficiency virus 1 infection pvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105295781 (PPP3R1)    04310 Wnt signaling pathway     105295781 (PPP3R1)    04370 VEGF signaling pathway     105295781 (PPP3R1)    04020 Calcium signaling pathway     105295781 (PPP3R1)    04022 cGMP-PKG signaling pathway     105295781 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105295781 (PPP3R1)    04218 Cellular senescence     105295781 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105295781 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     105295781 (PPP3R1)    04660 T cell receptor signaling pathway     105295781 (PPP3R1)    04658 Th1 and Th2 cell differentiation     105295781 (PPP3R1)    04659 Th17 cell differentiation     105295781 (PPP3R1)    04662 B cell receptor signaling pathway     105295781 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     105295781 (PPP3R1)    04921 Oxytocin signaling pathway     105295781 (PPP3R1)    04924 Renin secretion     105295781 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     105295781 (PPP3R1)    04720 Long-term potentiation     105295781 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     105295781 (PPP3R1)    04380 Osteoclast differentiation     105295781 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105295781 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105295781 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     105295781 (PPP3R1)    05163 Human cytomegalovirus infection     105295781 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     105295781 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     105295781 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     105295781 (PPP3R1)    05014 Amyotrophic lateral sclerosis     105295781 (PPP3R1)    05020 Prion disease     105295781 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     105295781 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     105295781 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105295781 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvp01009]     105295781 (PPP3R1) Protein phosphatases and associated proteins [BR:pvp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105295781 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  105295781 NCBI-ProteinID:  XP_011363903 UniProt:  A0A6P3QPH5 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctagggaagagatttaagaagcttgatttggacaattctggttctttgagcgtg gaagagttcatgtctctgccggagttacaacagaatccgttagtacagcgagtcatagat atattcgacacagatgggaatggagaagtagattttaaagaattcattgagggagtctct cagttcagtgtcaaaggcgataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system