Pteropus vampyrus (large flying fox): 105296305 Help Entry 105296305         CDS       T07815                                  Name (RefSeq) histone H2B 1/2-like   KO K11252   histone H2B Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05203   Viral carcinogenesis pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105296305  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105296305   09163 Immune disease    05322 Systemic lupus erythematosus     105296305   09165 Substance dependence    05034 Alcoholism     105296305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105296305   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105296305 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105296305 Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105296305 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF LonB_AAA-LID TFIID_20kDa Motif Other DBs NCBI-GeneID:  105296305 NCBI-ProteinID:  XP_011364634 UniProt:  A0A6P3QR43 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY TSSK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgcctggcg cactataacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgcctgctg ctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcaccaagtac accagctccaagtag

DBGET integrated database retrieval system