Pteropus vampyrus (large flying fox): 105296307 Help Entry 105296307         CDS       T07815                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05203   Viral carcinogenesis pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105296307  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105296307   09163 Immune disease    05322 Systemic lupus erythematosus     105296307   09165 Substance dependence    05034 Alcoholism     105296307  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105296307 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105296307 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  105296307 NCBI-ProteinID:  XP_023390173 UniProt:  A0A6P3QR47 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaaggggctcggcaagggcggcgccaagcgccatcgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcgcctggcgcgg cgcggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggggtgctcaag gtcttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcacgctctacggc ttcgggggctga

DBGET integrated database retrieval system