Pteropus vampyrus (large flying fox): 105296402 Help Entry 105296402         CDS       T07815                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04613   Neutrophil extracellular trap formation pvp05034   Alcoholism pvp05202   Transcriptional misregulation in cancer pvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pvp00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105296402  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105296402   09163 Immune disease    05322 Systemic lupus erythematosus     105296402   09165 Substance dependence    05034 Alcoholism     105296402  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105296402   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105296402 Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105296402 Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105296402 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105296402 NCBI-ProteinID:  XP_023390167 UniProt:  A0A6P6CRV1 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcggaccaagcagacggcgcgcaagtccacgggcgggaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggcgctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagagggcgtga

DBGET integrated database retrieval system