Pteropus vampyrus (large flying fox): 105296481 Help Entry 105296481         CDS       T07815                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04080   Neuroactive ligand-receptor interaction pvp04081   Hormone signaling pvp04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105296481 (GHRH)    04081 Hormone signaling     105296481 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     105296481 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvp04052]     105296481 (GHRH) Cytokines and neuropeptides [BR:pvp04052]  Neuropeptides   GPCR binding    105296481 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  105296481 NCBI-ProteinID:  XP_011364891 UniProt:  A0A6P3QRH6 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MLLWVFFIMILTLSNGSHSSPPSLPLRMPRYADAIFTNGYRKVLGQLSARKLLQDIMSRQ QGERNQEQGAKVRSGRQVDSMWADRKQMALESILVALPQKHRDSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcatcatgatcctcaccctcagcaatggctcccacagctcc ccgccctccctgcccctcaggatgccccggtatgcagatgccatcttcaccaacggctac cggaaggtgctgggccaactgtctgcccgcaagctgctccaggacatcatgagcaggcag cagggagagagaaaccaggaacaaggagcaaaggtacggtctggccgtcaggtggacagc atgtgggcagaccgaaagcagatggcattggagagcatcctggtggccctgccacagaag cacagggattcccaaggatga

DBGET integrated database retrieval system