Pteropus vampyrus (large flying fox): 105296550 Help Entry 105296550         CDS       T07815                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp01521   EGFR tyrosine kinase inhibitor resistance pvp01522   Endocrine resistance pvp04010   MAPK signaling pathway pvp04012   ErbB signaling pathway pvp04014   Ras signaling pathway pvp04015   Rap1 signaling pathway pvp04062   Chemokine signaling pathway pvp04068   FoxO signaling pathway pvp04071   Sphingolipid signaling pathway pvp04072   Phospholipase D signaling pathway pvp04137   Mitophagy - animal pvp04140   Autophagy - animal pvp04150   mTOR signaling pathway pvp04151   PI3K-Akt signaling pathway pvp04210   Apoptosis pvp04211   Longevity regulating pathway pvp04213   Longevity regulating pathway - multiple species pvp04218   Cellular senescence pvp04360   Axon guidance pvp04370   VEGF signaling pathway pvp04371   Apelin signaling pathway pvp04540   Gap junction pvp04550   Signaling pathways regulating pluripotency of stem cells pvp04625   C-type lectin receptor signaling pathway pvp04650   Natural killer cell mediated cytotoxicity pvp04660   T cell receptor signaling pathway pvp04662   B cell receptor signaling pathway pvp04664   Fc epsilon RI signaling pathway pvp04714   Thermogenesis pvp04720   Long-term potentiation pvp04722   Neurotrophin signaling pathway pvp04725   Cholinergic synapse pvp04726   Serotonergic synapse pvp04730   Long-term depression pvp04810   Regulation of actin cytoskeleton pvp04910   Insulin signaling pathway pvp04912   GnRH signaling pathway pvp04915   Estrogen signaling pathway pvp04916   Melanogenesis pvp04917   Prolactin signaling pathway pvp04919   Thyroid hormone signaling pathway pvp04921   Oxytocin signaling pathway pvp04926   Relaxin signaling pathway pvp04929   GnRH secretion pvp04933   AGE-RAGE signaling pathway in diabetic complications pvp04935   Growth hormone synthesis, secretion and action pvp05010   Alzheimer disease pvp05022   Pathways of neurodegeneration - multiple diseases pvp05034   Alcoholism pvp05160   Hepatitis C pvp05161   Hepatitis B pvp05163   Human cytomegalovirus infection pvp05165   Human papillomavirus infection pvp05166   Human T-cell leukemia virus 1 infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05170   Human immunodeficiency virus 1 infection pvp05200   Pathways in cancer pvp05203   Viral carcinogenesis pvp05205   Proteoglycans in cancer pvp05206   MicroRNAs in cancer pvp05207   Chemical carcinogenesis - receptor activation pvp05208   Chemical carcinogenesis - reactive oxygen species pvp05210   Colorectal cancer pvp05211   Renal cell carcinoma pvp05213   Endometrial cancer pvp05214   Glioma pvp05215   Prostate cancer pvp05216   Thyroid cancer pvp05218   Melanoma pvp05219   Bladder cancer pvp05220   Chronic myeloid leukemia pvp05221   Acute myeloid leukemia pvp05223   Non-small cell lung cancer pvp05224   Breast cancer pvp05225   Hepatocellular carcinoma pvp05226   Gastric cancer pvp05230   Central carbon metabolism in cancer pvp05231   Choline metabolism in cancer pvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105296550 (NRAS)    04012 ErbB signaling pathway     105296550 (NRAS)    04014 Ras signaling pathway     105296550 (NRAS)    04015 Rap1 signaling pathway     105296550 (NRAS)    04370 VEGF signaling pathway     105296550 (NRAS)    04371 Apelin signaling pathway     105296550 (NRAS)    04068 FoxO signaling pathway     105296550 (NRAS)    04072 Phospholipase D signaling pathway     105296550 (NRAS)    04071 Sphingolipid signaling pathway     105296550 (NRAS)    04151 PI3K-Akt signaling pathway     105296550 (NRAS)    04150 mTOR signaling pathway     105296550 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105296550 (NRAS)    04137 Mitophagy - animal     105296550 (NRAS)   09143 Cell growth and death    04210 Apoptosis     105296550 (NRAS)    04218 Cellular senescence     105296550 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     105296550 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     105296550 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105296550 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105296550 (NRAS)    04650 Natural killer cell mediated cytotoxicity     105296550 (NRAS)    04660 T cell receptor signaling pathway     105296550 (NRAS)    04662 B cell receptor signaling pathway     105296550 (NRAS)    04664 Fc epsilon RI signaling pathway     105296550 (NRAS)    04062 Chemokine signaling pathway     105296550 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     105296550 (NRAS)    04929 GnRH secretion     105296550 (NRAS)    04912 GnRH signaling pathway     105296550 (NRAS)    04915 Estrogen signaling pathway     105296550 (NRAS)    04917 Prolactin signaling pathway     105296550 (NRAS)    04921 Oxytocin signaling pathway     105296550 (NRAS)    04926 Relaxin signaling pathway     105296550 (NRAS)    04935 Growth hormone synthesis, secretion and action     105296550 (NRAS)    04919 Thyroid hormone signaling pathway     105296550 (NRAS)    04916 Melanogenesis     105296550 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     105296550 (NRAS)    04726 Serotonergic synapse     105296550 (NRAS)    04720 Long-term potentiation     105296550 (NRAS)    04730 Long-term depression     105296550 (NRAS)    04722 Neurotrophin signaling pathway     105296550 (NRAS)   09158 Development and regeneration    04360 Axon guidance     105296550 (NRAS)   09149 Aging    04211 Longevity regulating pathway     105296550 (NRAS)    04213 Longevity regulating pathway - multiple species     105296550 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     105296550 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105296550 (NRAS)    05206 MicroRNAs in cancer     105296550 (NRAS)    05205 Proteoglycans in cancer     105296550 (NRAS)    05207 Chemical carcinogenesis - receptor activation     105296550 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     105296550 (NRAS)    05203 Viral carcinogenesis     105296550 (NRAS)    05230 Central carbon metabolism in cancer     105296550 (NRAS)    05231 Choline metabolism in cancer     105296550 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105296550 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     105296550 (NRAS)    05225 Hepatocellular carcinoma     105296550 (NRAS)    05226 Gastric cancer     105296550 (NRAS)    05214 Glioma     105296550 (NRAS)    05216 Thyroid cancer     105296550 (NRAS)    05221 Acute myeloid leukemia     105296550 (NRAS)    05220 Chronic myeloid leukemia     105296550 (NRAS)    05218 Melanoma     105296550 (NRAS)    05211 Renal cell carcinoma     105296550 (NRAS)    05219 Bladder cancer     105296550 (NRAS)    05215 Prostate cancer     105296550 (NRAS)    05213 Endometrial cancer     105296550 (NRAS)    05224 Breast cancer     105296550 (NRAS)    05223 Non-small cell lung cancer     105296550 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105296550 (NRAS)    05170 Human immunodeficiency virus 1 infection     105296550 (NRAS)    05161 Hepatitis B     105296550 (NRAS)    05160 Hepatitis C     105296550 (NRAS)    05163 Human cytomegalovirus infection     105296550 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     105296550 (NRAS)    05165 Human papillomavirus infection     105296550 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105296550 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     105296550 (NRAS)   09165 Substance dependence    05034 Alcoholism     105296550 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105296550 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105296550 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105296550 (NRAS)    01522 Endocrine resistance     105296550 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105296550 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105296550 (NRAS)    04031 GTP-binding proteins [BR:pvp04031]     105296550 (NRAS) Membrane trafficking [BR:pvp04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105296550 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     105296550 (NRAS) Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105296550 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    105296550 (NRAS)   Exosomal proteins of breast cancer cells    105296550 (NRAS)   Exosomal proteins of colorectal cancer cells    105296550 (NRAS) GTP-binding proteins [BR:pvp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105296550 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  105296550 NCBI-ProteinID:  XP_011364997 UniProt:  A0A6P3QKY0 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLTTVKVLASEKSHCQAALTPAL VLTSWRTLPLSPSPVSQRRARYFPSSR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgacc atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggtgatagacggtgagacctgtctgttggacatcctggacacagctgga caggaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgc gtgtttgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt aagcgagtaaaggactcagatgatgtacctatggtgctagtagggaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactgaca actgttaaagttctagcatcagaaaagagccactgtcaagctgcactgacacccgccctg gtcctgacttcctggaggacactccccctgtcgccctctccagtctcacagagacgcgcc cgctacttccccagctctcggtag

DBGET integrated database retrieval system