Pteropus vampyrus (large flying fox): 105296867 Help Entry 105296867         CDS       T07815                                  Symbol TMEM218 Name (RefSeq) transmembrane protein 218   KO K26674   transmembrane protein 218 Organism pvp  Pteropus vampyrus (large flying fox) Brite KEGG Orthology (KO) [BR:pvp00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvp03037]     105296867 (TMEM218) Cilium and associated proteins [BR:pvp03037]  Primary cilia and associated proteins   MKS complex    105296867 (TMEM218) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DUF6418 TgpA_N Motif Other DBs NCBI-GeneID:  105296867 NCBI-ProteinID:  XP_011365524 UniProt:  A0A6P3QJZ1 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGTVLGVGAGVFILALLWVLVLLLCALLSRASGVARFSVIFVFLGAVVITSVLLLFPRA SEIPAPAVEMKNAGL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggcactgtcctgggagtgggtgccggcgtgttcatcttagccctgctctgggtg ctggtgctgctgctgtgtgcgctgttgtccagagcctctggtgtagccaggttctctgtc atttttgtattcctcggtgctgtggtcatcacgtcagttctgttgctcttcccccgagcc agtgaaatcccagccccagcggtcgaaatgaagaatgctgggttatga

DBGET integrated database retrieval system