Pteropus vampyrus (large flying fox): 105299957 Help Entry 105299957         CDS       T07815                                  Symbol ARF1 Name (RefSeq) ADP-ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04072   Phospholipase D signaling pathway pvp04144   Endocytosis pvp05132   Salmonella infection pvp05134   Legionellosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     105299957 (ARF1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105299957 (ARF1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105299957 (ARF1)    05134 Legionellosis     105299957 (ARF1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105299957 (ARF1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105299957 (ARF1)    04031 GTP-binding proteins [BR:pvp04031]     105299957 (ARF1) Membrane trafficking [BR:pvp04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     105299957 (ARF1)   Arf GTPases and associated proteins    Arf GTPases     105299957 (ARF1)  Endosome - Golgi transport     105299957 (ARF1) Exosome [BR:pvp04147]  Exosomal proteins   Proteins found in most exosomes    105299957 (ARF1) GTP-binding proteins [BR:pvp04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     105299957 (ARF1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M Motif Other DBs NCBI-GeneID:  105299957 NCBI-ProteinID:  XP_011370242 UniProt:  A0A6P3QUR5 LinkDB All DBs Position Unknown AA seq 181 aa AA seqDB search MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggggaatatctttgcgaacctcttcaagggcctttttggcaaaaaagaaatgcgcatt ctcatggtaggcctggacgctgcagggaagaccaccatcctgtacaaactaaagctgggt gagatcgtgaccaccatccccaccataggcttcaatgtagagacggtggagtacaagaac atcagcttcactgtgtgggatgtgggcggccaggacaagatccgacctctgtggcgccac tacttccagaacacacaaggtctcatttttgtggttgacagcaatgaccgagaacgtgta aacgaggcccgtgaagagctcatgcggatgttggcagaggacgagctcagggatgctgtc ctgctcgtgtttgcaaacaagcaggacctccccaatgccatgaatgctgccgagatcacg gacaagctgggcctgcactctctgcgccacaggaactggtacattcaggccacctgtgcc accagtggcgatgggctctatgagggactggactggctgtccaatcagctccggaaccag aagtga

DBGET integrated database retrieval system