Pteropus vampyrus (large flying fox): 105300273 Help Entry 105300273         CDS       T07815                                  Symbol CAV2 Name (RefSeq) caveolin-2   KO K12958   caveolin 2 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04144   Endocytosis pvp04510   Focal adhesion pvp05020   Prion disease pvp05100   Bacterial invasion of epithelial cells pvp05205   Proteoglycans in cancer pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105300273 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105300273 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105300273 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105300273 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     105300273 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105300273 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105300273 (CAV2) Membrane trafficking [BR:pvp04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     105300273 (CAV2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  105300273 NCBI-ProteinID:  XP_011370698 UniProt:  A0A6P3RA64 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MGLETEKADVQLFMDDDSYSRHSGVDYADPEKFADSGQDRDPNRLNSHLKVGFEDVIAEP LSAHSFDKVWICSHALFEVSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVK TCLMVLPSVQTIWKSVTDVLIAPLSTSVGRIFSSVSLQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagactgagaaggcggacgtccagctcttcatggacgacgactcctacagc cgccacagcggcgtagactacgccgaccccgagaagttcgcggattctggccaggatcgg gatccgaacagactcaactcgcatctcaaggtgggcttcgaagatgtgatcgcggagccc ttgtctgcgcactcctttgacaaagtgtggatctgcagccatgccctctttgaagtcagc aaatatgtgatttacaagttcttgacagtgttcctggctatccccctggcctttgctgca ggaattctctttgccaccctcagctgtctgcacatctggattataatgccttttgtcaag acctgcctaatggtcctgccttcagtgcagacgatatggaagagtgtgacagatgttctc attgccccattgtccacgagtgtaggacgcatcttctcctctgtcagcttgcaactgagc catgactga

DBGET integrated database retrieval system