Pteropus vampyrus (large flying fox): 105301523 Help Entry 105301523         CDS       T07815                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04015   Rap1 signaling pathway pvp04810   Regulation of actin cytoskeleton pvp05014   Amyotrophic lateral sclerosis pvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105301523 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105301523 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105301523 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105301523 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105301523 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pvp04812]     105301523 (PFN2)    04147 Exosome [BR:pvp04147]     105301523 (PFN2) Membrane trafficking [BR:pvp04131]  Others   Actin-binding proteins    Others     105301523 (PFN2) Cytoskeleton proteins [BR:pvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105301523 (PFN2) Exosome [BR:pvp04147]  Exosomal proteins   Proteins found in most exosomes    105301523 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105301523 NCBI-ProteinID:  XP_011372527 UniProt:  A0A6P3RDY0 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaagaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgagaaggtttcttt accaacggtttgactcttggtgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagccaaggtggtgagccaacatacaac gttgctgtgggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system