Pteropus vampyrus (large flying fox): 105301735 Help Entry 105301735         CDS       T07815                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04010   MAPK signaling pathway pvp04014   Ras signaling pathway pvp04015   Rap1 signaling pathway pvp04024   cAMP signaling pathway pvp04072   Phospholipase D signaling pathway pvp04137   Mitophagy - animal pvp04140   Autophagy - animal pvp04218   Cellular senescence pvp04360   Axon guidance pvp04371   Apelin signaling pathway pvp04625   C-type lectin receptor signaling pathway pvp04810   Regulation of actin cytoskeleton pvp05132   Salmonella infection pvp05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105301735 (RRAS)    04014 Ras signaling pathway     105301735 (RRAS)    04015 Rap1 signaling pathway     105301735 (RRAS)    04371 Apelin signaling pathway     105301735 (RRAS)    04072 Phospholipase D signaling pathway     105301735 (RRAS)    04024 cAMP signaling pathway     105301735 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105301735 (RRAS)    04137 Mitophagy - animal     105301735 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     105301735 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105301735 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105301735 (RRAS)   09158 Development and regeneration    04360 Axon guidance     105301735 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105301735 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105301735 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pvp04031]     105301735 (RRAS) GTP-binding proteins [BR:pvp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105301735 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Arf Roc Abhydrolase_4 Motif Other DBs NCBI-GeneID:  105301735 NCBI-ProteinID:  XP_011372833 UniProt:  A0A6P3REM3 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLETQRQV PRSEASTFSASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKDGS CPCVLL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgagagagcagtacatgcgcgccgggcacggtttcctgctggtgtttgccattaatgac cggcagagtttcaacgaggtgggcaagctgttcacgcagatcctccgagtcaaggaccgt gacgacttccccatcgtgttggttgggaacaaggcagacctcgagacacagcgtcaggtc ccccgatctgaagcgtccaccttcagtgcctcccaccacgtggcctacttcgaggcctcg gccaaactgcgcctcaacgtggacgaggccttcgagcagctggtgcgggctgtccgtaag taccaggaacaagagctcccgcccagcccgcccagtgcccccaggaagaaggacgggagc tgcccctgcgtcctcctgtag

DBGET integrated database retrieval system