Pteropus vampyrus (large flying fox): 105302355 Help Entry 105302355         CDS       T07815                                  Name (RefSeq) nucleoside diphosphate kinase 6   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp00230   Purine metabolism pvp00240   Pyrimidine metabolism pvp00983   Drug metabolism - other enzymes pvp01100   Metabolic pathways pvp01232   Nucleotide metabolism pvp01240   Biosynthesis of cofactors Module pvp_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP pvp_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP pvp_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP pvp_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP pvp_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:pvp00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     105302355    00240 Pyrimidine metabolism     105302355   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     105302355  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105302355 Enzymes [BR:pvp01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      105302355 Membrane trafficking [BR:pvp04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     105302355 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  105302355 NCBI-ProteinID:  XP_011373665 UniProt:  A0A6P6BMN8 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVV SASREIAAFFPDFSEQRWYEEEEPQLRCGPVHYSPEGGIHCAARTGGPGPA NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagtggaccaatccgagcctacatcctcgcccacaaggatgccatccagctctgg aggacactgatgggacccactagagtgtttcgagcacggcacgtggctccggattccatt cgtgggagtttcggcctcaccgacacccgcaacaccacccatggttccgactctgtggtt tcggccagtagagagattgcagccttcttccctgacttcagtgaacagcgctggtatgag gaagaggagccccagttgcgctgtggccccgtgcactacagtccggagggaggcatccac tgtgcagccagaacaggaggcccgggaccagcctga

DBGET integrated database retrieval system