Pteropus vampyrus (large flying fox): 105302383 Help Entry 105302383         CDS       T07815                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04014   Ras signaling pathway pvp04015   Rap1 signaling pathway pvp04022   cGMP-PKG signaling pathway pvp04024   cAMP signaling pathway pvp04062   Chemokine signaling pathway pvp04071   Sphingolipid signaling pathway pvp04072   Phospholipase D signaling pathway pvp04081   Hormone signaling pvp04144   Endocytosis pvp04150   mTOR signaling pathway pvp04270   Vascular smooth muscle contraction pvp04310   Wnt signaling pathway pvp04350   TGF-beta signaling pathway pvp04360   Axon guidance pvp04510   Focal adhesion pvp04520   Adherens junction pvp04530   Tight junction pvp04611   Platelet activation pvp04621   NOD-like receptor signaling pathway pvp04625   C-type lectin receptor signaling pathway pvp04660   T cell receptor signaling pathway pvp04670   Leukocyte transendothelial migration pvp04722   Neurotrophin signaling pathway pvp04810   Regulation of actin cytoskeleton pvp04921   Oxytocin signaling pathway pvp04928   Parathyroid hormone synthesis, secretion and action pvp04972   Pancreatic secretion pvp05100   Bacterial invasion of epithelial cells pvp05132   Salmonella infection pvp05133   Pertussis pvp05135   Yersinia infection pvp05152   Tuberculosis pvp05163   Human cytomegalovirus infection pvp05200   Pathways in cancer pvp05203   Viral carcinogenesis pvp05205   Proteoglycans in cancer pvp05206   MicroRNAs in cancer pvp05210   Colorectal cancer pvp05417   Lipid and atherosclerosis pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105302383 (RHOA)    04015 Rap1 signaling pathway     105302383 (RHOA)    04310 Wnt signaling pathway     105302383 (RHOA)    04350 TGF-beta signaling pathway     105302383 (RHOA)    04072 Phospholipase D signaling pathway     105302383 (RHOA)    04071 Sphingolipid signaling pathway     105302383 (RHOA)    04024 cAMP signaling pathway     105302383 (RHOA)    04022 cGMP-PKG signaling pathway     105302383 (RHOA)    04150 mTOR signaling pathway     105302383 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     105302383 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105302383 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105302383 (RHOA)    04520 Adherens junction     105302383 (RHOA)    04530 Tight junction     105302383 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105302383 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     105302383 (RHOA)    04621 NOD-like receptor signaling pathway     105302383 (RHOA)    04625 C-type lectin receptor signaling pathway     105302383 (RHOA)    04660 T cell receptor signaling pathway     105302383 (RHOA)    04670 Leukocyte transendothelial migration     105302383 (RHOA)    04062 Chemokine signaling pathway     105302383 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     105302383 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     105302383 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105302383 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     105302383 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     105302383 (RHOA)   09158 Development and regeneration    04360 Axon guidance     105302383 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105302383 (RHOA)    05206 MicroRNAs in cancer     105302383 (RHOA)    05205 Proteoglycans in cancer     105302383 (RHOA)    05203 Viral carcinogenesis     105302383 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     105302383 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105302383 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     105302383 (RHOA)    05135 Yersinia infection     105302383 (RHOA)    05133 Pertussis     105302383 (RHOA)    05152 Tuberculosis     105302383 (RHOA)    05100 Bacterial invasion of epithelial cells     105302383 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105302383 (RHOA)    05418 Fluid shear stress and atherosclerosis     105302383 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105302383 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105302383 (RHOA)    04031 GTP-binding proteins [BR:pvp04031]     105302383 (RHOA) Membrane trafficking [BR:pvp04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105302383 (RHOA) Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105302383 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    105302383 (RHOA)   Exosomal proteins of colorectal cancer cells    105302383 (RHOA)   Exosomal proteins of bladder cancer cells    105302383 (RHOA) GTP-binding proteins [BR:pvp04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105302383 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  105302383 NCBI-ProteinID:  XP_011373721 UniProt:  A0A6P6BMQ9 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaattggtgattgttggtgatggagcctgtggcaagacctgc ttgcttatcgtttttagcaaggaccagtttccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcccctctcctacccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaatgtgcccatcatcctggttggaaacaagaaggac cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa ccagaagaaggcagagatatggcgaacaggattggcgcttttgggtacatggagtgttca gcaaaaaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system