Pteropus vampyrus (large flying fox): 105303001 Help Entry 105303001         CDS       T07815                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04814   Motor proteins pvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pvp00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105303001 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105303001 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvp03037]     105303001 (DYNLT1)    04812 Cytoskeleton proteins [BR:pvp04812]     105303001 (DYNLT1) Cilium and associated proteins [BR:pvp03037]  Motile cilia and associated proteins   Dynein arm    105303001 (DYNLT1) Cytoskeleton proteins [BR:pvp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105303001 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  105303001 NCBI-ProteinID:  XP_023376868 UniProt:  A0A6P6BP40 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search CCSGYESFKSNNSFSSLQTSFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTL SQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSTFGL SI NT seq 369 nt NT seq  +upstreamnt  +downstreamnt tgctgcagtggatacgaatcttttaaatcaaacaactcattttcttccttacagacttca tttgttgttgacgaagtgagcaacattgtaaaagaggctatagagagcgccattggtggc aacgcctatcagcacagcaaagtgaatcaatggaccacgaatgtagtagaacaaacttta agccaactcaccaagctgggaaaaccatttaaatacattgtgacctgtgtaattatgcag aagaatggagcaggattacacacggcaagttcatgcttctgggacagctctactgacggg agctgcacggtgcgatgggagaacaagaccatgtactgcatcgtcagcaccttcgggctg tccatctga

DBGET integrated database retrieval system