Pteropus vampyrus (large flying fox): 105303182 Help Entry 105303182         CDS       T07815                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04024   cAMP signaling pathway pvp04062   Chemokine signaling pathway pvp04064   NF-kappa B signaling pathway pvp04210   Apoptosis pvp04380   Osteoclast differentiation pvp04620   Toll-like receptor signaling pathway pvp04621   NOD-like receptor signaling pathway pvp04622   RIG-I-like receptor signaling pathway pvp04623   Cytosolic DNA-sensing pathway pvp04625   C-type lectin receptor signaling pathway pvp04657   IL-17 signaling pathway pvp04658   Th1 and Th2 cell differentiation pvp04659   Th17 cell differentiation pvp04660   T cell receptor signaling pathway pvp04662   B cell receptor signaling pathway pvp04668   TNF signaling pathway pvp04722   Neurotrophin signaling pathway pvp04920   Adipocytokine signaling pathway pvp04926   Relaxin signaling pathway pvp04931   Insulin resistance pvp04936   Alcoholic liver disease pvp05132   Salmonella infection pvp05134   Legionellosis pvp05135   Yersinia infection pvp05140   Leishmaniasis pvp05142   Chagas disease pvp05145   Toxoplasmosis pvp05160   Hepatitis C pvp05161   Hepatitis B pvp05162   Measles pvp05163   Human cytomegalovirus infection pvp05164   Influenza A pvp05166   Human T-cell leukemia virus 1 infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05168   Herpes simplex virus 1 infection pvp05169   Epstein-Barr virus infection pvp05170   Human immunodeficiency virus 1 infection pvp05171   Coronavirus disease - COVID-19 pvp05200   Pathways in cancer pvp05203   Viral carcinogenesis pvp05208   Chemical carcinogenesis - reactive oxygen species pvp05215   Prostate cancer pvp05220   Chronic myeloid leukemia pvp05222   Small cell lung cancer pvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105303182 (NFKBIA)    04668 TNF signaling pathway     105303182 (NFKBIA)    04024 cAMP signaling pathway     105303182 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105303182 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105303182 (NFKBIA)    04621 NOD-like receptor signaling pathway     105303182 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     105303182 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     105303182 (NFKBIA)    04625 C-type lectin receptor signaling pathway     105303182 (NFKBIA)    04660 T cell receptor signaling pathway     105303182 (NFKBIA)    04658 Th1 and Th2 cell differentiation     105303182 (NFKBIA)    04659 Th17 cell differentiation     105303182 (NFKBIA)    04657 IL-17 signaling pathway     105303182 (NFKBIA)    04662 B cell receptor signaling pathway     105303182 (NFKBIA)    04062 Chemokine signaling pathway     105303182 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105303182 (NFKBIA)    04926 Relaxin signaling pathway     105303182 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     105303182 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     105303182 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105303182 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     105303182 (NFKBIA)    05203 Viral carcinogenesis     105303182 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105303182 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     105303182 (NFKBIA)    05215 Prostate cancer     105303182 (NFKBIA)    05222 Small cell lung cancer     105303182 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105303182 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     105303182 (NFKBIA)    05161 Hepatitis B     105303182 (NFKBIA)    05160 Hepatitis C     105303182 (NFKBIA)    05171 Coronavirus disease - COVID-19     105303182 (NFKBIA)    05164 Influenza A     105303182 (NFKBIA)    05162 Measles     105303182 (NFKBIA)    05168 Herpes simplex virus 1 infection     105303182 (NFKBIA)    05163 Human cytomegalovirus infection     105303182 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     105303182 (NFKBIA)    05169 Epstein-Barr virus infection     105303182 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     105303182 (NFKBIA)    05135 Yersinia infection     105303182 (NFKBIA)    05134 Legionellosis     105303182 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105303182 (NFKBIA)    05140 Leishmaniasis     105303182 (NFKBIA)    05142 Chagas disease     105303182 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105303182 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105303182 (NFKBIA)    04931 Insulin resistance     105303182 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pvp03000]     105303182 (NFKBIA)    04131 Membrane trafficking [BR:pvp04131]     105303182 (NFKBIA) Transcription factors [BR:pvp03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     105303182 (NFKBIA) Membrane trafficking [BR:pvp04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105303182 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  105303182 NCBI-ProteinID:  XP_011374970 UniProt:  A0A6P3RJC5 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGTQHLHSVLQAAN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQLLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagcccgccgagcacgcccaggactgggctatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgactatggaagtggtccgccaagtgaagggagac ctggcctttcttaacttccagaacaacctgcagcagactccactccacttggctgtgatt accaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggttgcctggccagtgtg ggagtcctgactcagagctgtggaacccagcacctccactctgtcctgcaggccgccaac tacaatggccacacgtgtctgcacttagcctctatccatggctacctgggcatcgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc cttcatcttgcggtggacctgcagaatcctgacctggtgtcactgttgttgaagtgtggg gctgacgtcaacagagtcacgtaccagggctactctccataccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagttgctg ccagagagtgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg ccttatgatgactgtgtgcttggaggccagcgcctaacgttatga

DBGET integrated database retrieval system