Pteropus vampyrus (large flying fox): 105303606 Help Entry 105303606         CDS       T07815                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04014   Ras signaling pathway pvp04015   Rap1 signaling pathway pvp04020   Calcium signaling pathway pvp04022   cGMP-PKG signaling pathway pvp04024   cAMP signaling pathway pvp04070   Phosphatidylinositol signaling system pvp04114   Oocyte meiosis pvp04218   Cellular senescence pvp04261   Adrenergic signaling in cardiomyocytes pvp04270   Vascular smooth muscle contraction pvp04371   Apelin signaling pathway pvp04625   C-type lectin receptor signaling pathway pvp04713   Circadian entrainment pvp04720   Long-term potentiation pvp04722   Neurotrophin signaling pathway pvp04728   Dopaminergic synapse pvp04740   Olfactory transduction pvp04744   Phototransduction pvp04750   Inflammatory mediator regulation of TRP channels pvp04910   Insulin signaling pathway pvp04912   GnRH signaling pathway pvp04915   Estrogen signaling pathway pvp04916   Melanogenesis pvp04921   Oxytocin signaling pathway pvp04922   Glucagon signaling pathway pvp04924   Renin secretion pvp04925   Aldosterone synthesis and secretion pvp04970   Salivary secretion pvp04971   Gastric acid secretion pvp05010   Alzheimer disease pvp05012   Parkinson disease pvp05022   Pathways of neurodegeneration - multiple diseases pvp05031   Amphetamine addiction pvp05034   Alcoholism pvp05133   Pertussis pvp05152   Tuberculosis pvp05163   Human cytomegalovirus infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05170   Human immunodeficiency virus 1 infection pvp05200   Pathways in cancer pvp05214   Glioma pvp05417   Lipid and atherosclerosis pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105303606 (CALML6)    04015 Rap1 signaling pathway     105303606 (CALML6)    04371 Apelin signaling pathway     105303606 (CALML6)    04020 Calcium signaling pathway     105303606 (CALML6)    04070 Phosphatidylinositol signaling system     105303606 (CALML6)    04024 cAMP signaling pathway     105303606 (CALML6)    04022 cGMP-PKG signaling pathway     105303606 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105303606 (CALML6)    04218 Cellular senescence     105303606 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105303606 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     105303606 (CALML6)    04922 Glucagon signaling pathway     105303606 (CALML6)    04912 GnRH signaling pathway     105303606 (CALML6)    04915 Estrogen signaling pathway     105303606 (CALML6)    04921 Oxytocin signaling pathway     105303606 (CALML6)    04916 Melanogenesis     105303606 (CALML6)    04924 Renin secretion     105303606 (CALML6)    04925 Aldosterone synthesis and secretion     105303606 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     105303606 (CALML6)    04270 Vascular smooth muscle contraction     105303606 (CALML6)   09154 Digestive system    04970 Salivary secretion     105303606 (CALML6)    04971 Gastric acid secretion     105303606 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     105303606 (CALML6)    04720 Long-term potentiation     105303606 (CALML6)    04722 Neurotrophin signaling pathway     105303606 (CALML6)   09157 Sensory system    04744 Phototransduction     105303606 (CALML6)    04740 Olfactory transduction     105303606 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     105303606 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     105303606 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105303606 (CALML6)   09162 Cancer: specific types    05214 Glioma     105303606 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105303606 (CALML6)    05163 Human cytomegalovirus infection     105303606 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     105303606 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     105303606 (CALML6)    05152 Tuberculosis     105303606 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     105303606 (CALML6)    05012 Parkinson disease     105303606 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     105303606 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     105303606 (CALML6)    05034 Alcoholism     105303606 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105303606 (CALML6)    05418 Fluid shear stress and atherosclerosis     105303606 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvp01009]     105303606 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105303606 (CALML6)    03036 Chromosome and associated proteins [BR:pvp03036]     105303606 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pvp04147]     105303606 (CALML6) Protein phosphatases and associated proteins [BR:pvp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105303606 (CALML6) Membrane trafficking [BR:pvp04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     105303606 (CALML6) Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      105303606 (CALML6) Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105303606 (CALML6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF_EFCAB10_C EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  105303606 NCBI-ProteinID:  XP_011375640 UniProt:  A0A6P3R5P8 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search MSPQSERLTAEQVKEYKGVFEMFDEEGNGEVKTGELERLMSLLGINPTKSELASMAKDVD RDNKGFFNCNSFLALMGIYWEKAQNQESELRAAFRVFDKEGKGYIDWDTLKYVLMNAGEP LNEVEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtccccgcagtcggagcgtctgacggccgagcaagtcaaggagtacaagggcgtcttc gagatgtttgacgaggagggcaacggagaggtcaagacgggggagctggagcggctcatg agcctgctgggcatcaaccccaccaagagcgagctggcctccatggccaaggacgtggac agagacaacaaaggcttcttcaactgcaacagcttcttggccctgatgggcatttactgg gagaaggcccagaaccaggagagcgagctgagggcggcttttcgtgtcttcgacaaggag ggcaagggctacatcgactgggacacgctcaagtacgtgctcatgaacgcaggcgagccc ctcaacgaggtggaggctgagcagatgatgaaggaggctgacaaggacggggacgggacc atcgactacgaggagttcgtggccatgatgaccggagagtccttcaagctggtccagtag

DBGET integrated database retrieval system