Pteropus vampyrus (large flying fox): 105303777 Help Entry 105303777         CDS       T07815                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04072   Phospholipase D signaling pathway pvp04140   Autophagy - animal pvp04150   mTOR signaling pathway pvp04151   PI3K-Akt signaling pathway pvp04152   AMPK signaling pathway pvp04211   Longevity regulating pathway pvp04218   Cellular senescence pvp04714   Thermogenesis pvp04910   Insulin signaling pathway pvp04919   Thyroid hormone signaling pathway pvp05163   Human cytomegalovirus infection pvp05165   Human papillomavirus infection pvp05168   Herpes simplex virus 1 infection pvp05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     105303777 (RHEB)    04151 PI3K-Akt signaling pathway     105303777 (RHEB)    04152 AMPK signaling pathway     105303777 (RHEB)    04150 mTOR signaling pathway     105303777 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105303777 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     105303777 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105303777 (RHEB)    04919 Thyroid hormone signaling pathway     105303777 (RHEB)   09149 Aging    04211 Longevity regulating pathway     105303777 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     105303777 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     105303777 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     105303777 (RHEB)    05163 Human cytomegalovirus infection     105303777 (RHEB)    05165 Human papillomavirus infection     105303777 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pvp04031]     105303777 (RHEB) GTP-binding proteins [BR:pvp04031]  Small (monomeric) G-proteins   Ras Family    Rheb     105303777 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  105303777 NCBI-ProteinID:  XP_023377548 UniProt:  A0A6P6BR27 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search NRRVTFLCLDTPVYTELLLAFTGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYH LQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIM LVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAAS QGKSSCSVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt aatcggagggttacatttttgtgccttgatacgccagtgtatactgaactgttgcttgct tttacagggaaatcctcattgacgattcagtttgtcgaaggccaatttgtggactcctac gatccaaccatagagaacactttcacaaaattgatcacagtaaatggacaagaatatcat cttcaacttgtagacacagctgggcaagatgaatattccatctttcctcagacatactcc atagatattaatggttacattctcgtgtattctgttacatcaatcaaaagtttcgaagtg attaaagttatccacggcaagttgttggacatggtggggaaagtgcaaatacctattatg ttggttggcaataagaaagacctacatatggaaagggtgatcagttatgaagaagggaag gcgttagcagaatcttggaatgcagcttttttggaatcttctgctaaagaaaatcagacc gctgttgatgtttttagaaggataattttggaggcagaaaaaatcgatggggccgcttca caaggaaagtcttcctgctcagtgatgtaa

DBGET integrated database retrieval system