Pteropus vampyrus (large flying fox): 105305503 Help Entry 105305503         CDS       T07815                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp01521   EGFR tyrosine kinase inhibitor resistance pvp01524   Platinum drug resistance pvp04014   Ras signaling pathway pvp04064   NF-kappa B signaling pathway pvp04115   p53 signaling pathway pvp04137   Mitophagy - animal pvp04140   Autophagy - animal pvp04151   PI3K-Akt signaling pathway pvp04210   Apoptosis pvp04215   Apoptosis - multiple species pvp04621   NOD-like receptor signaling pathway pvp04630   JAK-STAT signaling pathway pvp05012   Parkinson disease pvp05014   Amyotrophic lateral sclerosis pvp05022   Pathways of neurodegeneration - multiple diseases pvp05145   Toxoplasmosis pvp05162   Measles pvp05166   Human T-cell leukemia virus 1 infection pvp05168   Herpes simplex virus 1 infection pvp05170   Human immunodeficiency virus 1 infection pvp05200   Pathways in cancer pvp05202   Transcriptional misregulation in cancer pvp05212   Pancreatic cancer pvp05220   Chronic myeloid leukemia pvp05222   Small cell lung cancer pvp05225   Hepatocellular carcinoma pvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105305503 (BCL2L1)    04630 JAK-STAT signaling pathway     105305503 (BCL2L1)    04064 NF-kappa B signaling pathway     105305503 (BCL2L1)    04151 PI3K-Akt signaling pathway     105305503 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105305503 (BCL2L1)    04137 Mitophagy - animal     105305503 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     105305503 (BCL2L1)    04215 Apoptosis - multiple species     105305503 (BCL2L1)    04115 p53 signaling pathway     105305503 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105305503 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105305503 (BCL2L1)    05202 Transcriptional misregulation in cancer     105305503 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     105305503 (BCL2L1)    05225 Hepatocellular carcinoma     105305503 (BCL2L1)    05220 Chronic myeloid leukemia     105305503 (BCL2L1)    05222 Small cell lung cancer     105305503 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105305503 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     105305503 (BCL2L1)    05162 Measles     105305503 (BCL2L1)    05168 Herpes simplex virus 1 infection     105305503 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105305503 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     105305503 (BCL2L1)    05014 Amyotrophic lateral sclerosis     105305503 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     105305503 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105305503 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105305503 (BCL2L1)    01524 Platinum drug resistance     105305503 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pvp01009]     105305503 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pvp03036]     105305503 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pvp02000]     105305503 (BCL2L1) Protein phosphatases and associated proteins [BR:pvp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      105305503 (BCL2L1) Chromosome and associated proteins [BR:pvp03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105305503 (BCL2L1) Transporters [BR:pvp02000]  Other transporters   Pores ion channels [TC:1]    105305503 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  105305503 NCBI-ProteinID:  XP_011378440 UniProt:  A0A6P3RD88 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMEPPSAVNGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWLLTGVTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagttcagtgatgtggaagagaacagaactgaggccccagaagga actgaatcagagatggagccccccagtgccgtcaatggcaacccatcctggcacctggcg gacagccccgcagtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcagtgaaacaagcactgagggaagcaggtgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gttttggtgagtcggattgcaacttggatggctacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg gccgagagccggaagggtcaggagcgcttcaaccgctggcttctgacaggagtgactgtg gctggcgtggttctgctgggctcacttttcagtcggaaatga

DBGET integrated database retrieval system