Pteropus vampyrus (large flying fox): 105305637 Help Entry 105305637         CDS       T07815                                  Symbol CLDN11 Name (RefSeq) claudin-11   KO K06087   claudin Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp03272   Virion - Hepatitis viruses pvp04382   Cornified envelope formation pvp04514   Cell adhesion molecules pvp04530   Tight junction pvp04670   Leukocyte transendothelial migration pvp05160   Hepatitis C Brite KEGG Orthology (KO) [BR:pvp00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     105305637 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     105305637 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     105305637 (CLDN11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     105305637 (CLDN11)   09158 Development and regeneration    04382 Cornified envelope formation     105305637 (CLDN11)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     105305637 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pvp03037]     105305637 (CLDN11)    04147 Exosome [BR:pvp04147]     105305637 (CLDN11)    04515 Cell adhesion molecules [BR:pvp04515]     105305637 (CLDN11) Cilium and associated proteins [BR:pvp03037]  Other cilia and associated proteins   Stereociliary proteins    105305637 (CLDN11) Exosome [BR:pvp04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    105305637 (CLDN11)   Exosomal proteins of colorectal cancer cells    105305637 (CLDN11) Cell adhesion molecules [BR:pvp04515]  Immunoglobulin superfamily   L1 family    105305637 (CLDN11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-LITAF-like Motif Other DBs NCBI-GeneID:  105305637 NCBI-ProteinID:  XP_011378644 UniProt:  A0A6P3RDM7 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MMVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMA TGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRR AQLAGVMLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVIVCCS GDAQSFGENRFYYSSGSSSPTHAKSAHV NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgatggtggccacgtgtctgcaggtagtgggcttcgtcacgagtttcgtgggttggatc ggcatcatcgtcaccacgtccaccaatgactgggtggtgacctgcggctacaccatccct acctgccgcaagctggacgaactgggctccaaggggctgtgggctgactgcgtcatggcc acggggctctatcactgcaaacccctggtggacatcctcatcctgccgggctatgtgcag gcctgccgagccctgatgattgcagcctcagtcctgggtctgccggccattctcctgctg ctgacagttctcccctgcatccgaatgggccatgagcctggtgtggccaagtacaggagg gctcagctggctggcgttatgctcattcttctggctctctgtgccattgtggccaccatc tggttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtac gcgggctggatcggtgccgtgctgtgccttgtgggtggctgtgtcatcgtctgctgctct ggagatgcccagtcatttggcgaaaaccgtttctactactcttcgggttccagctcccct actcatgccaagagtgcccatgtatga

DBGET integrated database retrieval system