KEGG   Pteropus vampyrus (large flying fox): 105305933
Entry
105305933         CDS       T07815                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
pvp  Pteropus vampyrus (large flying fox)
Pathway
pvp01521  EGFR tyrosine kinase inhibitor resistance
pvp01522  Endocrine resistance
pvp04010  MAPK signaling pathway
pvp04012  ErbB signaling pathway
pvp04014  Ras signaling pathway
pvp04015  Rap1 signaling pathway
pvp04062  Chemokine signaling pathway
pvp04068  FoxO signaling pathway
pvp04071  Sphingolipid signaling pathway
pvp04072  Phospholipase D signaling pathway
pvp04137  Mitophagy - animal
pvp04140  Autophagy - animal
pvp04144  Endocytosis
pvp04150  mTOR signaling pathway
pvp04151  PI3K-Akt signaling pathway
pvp04210  Apoptosis
pvp04211  Longevity regulating pathway
pvp04213  Longevity regulating pathway - multiple species
pvp04218  Cellular senescence
pvp04360  Axon guidance
pvp04370  VEGF signaling pathway
pvp04371  Apelin signaling pathway
pvp04510  Focal adhesion
pvp04540  Gap junction
pvp04550  Signaling pathways regulating pluripotency of stem cells
pvp04625  C-type lectin receptor signaling pathway
pvp04630  JAK-STAT signaling pathway
pvp04650  Natural killer cell mediated cytotoxicity
pvp04660  T cell receptor signaling pathway
pvp04662  B cell receptor signaling pathway
pvp04664  Fc epsilon RI signaling pathway
pvp04714  Thermogenesis
pvp04720  Long-term potentiation
pvp04722  Neurotrophin signaling pathway
pvp04725  Cholinergic synapse
pvp04726  Serotonergic synapse
pvp04730  Long-term depression
pvp04810  Regulation of actin cytoskeleton
pvp04910  Insulin signaling pathway
pvp04912  GnRH signaling pathway
pvp04915  Estrogen signaling pathway
pvp04916  Melanogenesis
pvp04917  Prolactin signaling pathway
pvp04919  Thyroid hormone signaling pathway
pvp04921  Oxytocin signaling pathway
pvp04926  Relaxin signaling pathway
pvp04929  GnRH secretion
pvp04933  AGE-RAGE signaling pathway in diabetic complications
pvp04935  Growth hormone synthesis, secretion and action
pvp05010  Alzheimer disease
pvp05022  Pathways of neurodegeneration - multiple diseases
pvp05034  Alcoholism
pvp05132  Salmonella infection
pvp05160  Hepatitis C
pvp05161  Hepatitis B
pvp05163  Human cytomegalovirus infection
pvp05165  Human papillomavirus infection
pvp05166  Human T-cell leukemia virus 1 infection
pvp05167  Kaposi sarcoma-associated herpesvirus infection
pvp05170  Human immunodeficiency virus 1 infection
pvp05200  Pathways in cancer
pvp05203  Viral carcinogenesis
pvp05205  Proteoglycans in cancer
pvp05206  MicroRNAs in cancer
pvp05207  Chemical carcinogenesis - receptor activation
pvp05208  Chemical carcinogenesis - reactive oxygen species
pvp05210  Colorectal cancer
pvp05211  Renal cell carcinoma
pvp05213  Endometrial cancer
pvp05214  Glioma
pvp05215  Prostate cancer
pvp05216  Thyroid cancer
pvp05218  Melanoma
pvp05219  Bladder cancer
pvp05220  Chronic myeloid leukemia
pvp05221  Acute myeloid leukemia
pvp05223  Non-small cell lung cancer
pvp05224  Breast cancer
pvp05225  Hepatocellular carcinoma
pvp05226  Gastric cancer
pvp05230  Central carbon metabolism in cancer
pvp05231  Choline metabolism in cancer
pvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pvp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105305933 (HRAS)
   04012 ErbB signaling pathway
    105305933 (HRAS)
   04014 Ras signaling pathway
    105305933 (HRAS)
   04015 Rap1 signaling pathway
    105305933 (HRAS)
   04370 VEGF signaling pathway
    105305933 (HRAS)
   04371 Apelin signaling pathway
    105305933 (HRAS)
   04630 JAK-STAT signaling pathway
    105305933 (HRAS)
   04068 FoxO signaling pathway
    105305933 (HRAS)
   04072 Phospholipase D signaling pathway
    105305933 (HRAS)
   04071 Sphingolipid signaling pathway
    105305933 (HRAS)
   04151 PI3K-Akt signaling pathway
    105305933 (HRAS)
   04150 mTOR signaling pathway
    105305933 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105305933 (HRAS)
   04140 Autophagy - animal
    105305933 (HRAS)
   04137 Mitophagy - animal
    105305933 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105305933 (HRAS)
   04218 Cellular senescence
    105305933 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105305933 (HRAS)
   04540 Gap junction
    105305933 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105305933 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105305933 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105305933 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    105305933 (HRAS)
   04660 T cell receptor signaling pathway
    105305933 (HRAS)
   04662 B cell receptor signaling pathway
    105305933 (HRAS)
   04664 Fc epsilon RI signaling pathway
    105305933 (HRAS)
   04062 Chemokine signaling pathway
    105305933 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105305933 (HRAS)
   04929 GnRH secretion
    105305933 (HRAS)
   04912 GnRH signaling pathway
    105305933 (HRAS)
   04915 Estrogen signaling pathway
    105305933 (HRAS)
   04917 Prolactin signaling pathway
    105305933 (HRAS)
   04921 Oxytocin signaling pathway
    105305933 (HRAS)
   04926 Relaxin signaling pathway
    105305933 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    105305933 (HRAS)
   04919 Thyroid hormone signaling pathway
    105305933 (HRAS)
   04916 Melanogenesis
    105305933 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105305933 (HRAS)
   04726 Serotonergic synapse
    105305933 (HRAS)
   04720 Long-term potentiation
    105305933 (HRAS)
   04730 Long-term depression
    105305933 (HRAS)
   04722 Neurotrophin signaling pathway
    105305933 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105305933 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105305933 (HRAS)
   04213 Longevity regulating pathway - multiple species
    105305933 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105305933 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105305933 (HRAS)
   05206 MicroRNAs in cancer
    105305933 (HRAS)
   05205 Proteoglycans in cancer
    105305933 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    105305933 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105305933 (HRAS)
   05203 Viral carcinogenesis
    105305933 (HRAS)
   05230 Central carbon metabolism in cancer
    105305933 (HRAS)
   05231 Choline metabolism in cancer
    105305933 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105305933 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105305933 (HRAS)
   05225 Hepatocellular carcinoma
    105305933 (HRAS)
   05226 Gastric cancer
    105305933 (HRAS)
   05214 Glioma
    105305933 (HRAS)
   05216 Thyroid cancer
    105305933 (HRAS)
   05221 Acute myeloid leukemia
    105305933 (HRAS)
   05220 Chronic myeloid leukemia
    105305933 (HRAS)
   05218 Melanoma
    105305933 (HRAS)
   05211 Renal cell carcinoma
    105305933 (HRAS)
   05219 Bladder cancer
    105305933 (HRAS)
   05215 Prostate cancer
    105305933 (HRAS)
   05213 Endometrial cancer
    105305933 (HRAS)
   05224 Breast cancer
    105305933 (HRAS)
   05223 Non-small cell lung cancer
    105305933 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105305933 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    105305933 (HRAS)
   05161 Hepatitis B
    105305933 (HRAS)
   05160 Hepatitis C
    105305933 (HRAS)
   05163 Human cytomegalovirus infection
    105305933 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105305933 (HRAS)
   05165 Human papillomavirus infection
    105305933 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105305933 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105305933 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105305933 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    105305933 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105305933 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105305933 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105305933 (HRAS)
   01522 Endocrine resistance
    105305933 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvp04131]
    105305933 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvp04147]
    105305933 (HRAS)
   04031 GTP-binding proteins [BR:pvp04031]
    105305933 (HRAS)
Membrane trafficking [BR:pvp04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    105305933 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105305933 (HRAS)
Exosome [BR:pvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105305933 (HRAS)
  Exosomal proteins of colorectal cancer cells
   105305933 (HRAS)
GTP-binding proteins [BR:pvp04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105305933 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N
Other DBs
NCBI-GeneID: 105305933
NCBI-ProteinID: XP_011379077
UniProt: A0A6P3RCI5
LinkDB
Position
Unknown
AA seq 191 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYVETSAKTRQGSRSGSGSSSGTPGTQRPLALAWRTPSTRW
CARFGSTRCAS
NT seq 576 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgctggaggcgtggggaagagtgccctgacc
atccagctcatccagaaccacttcgtggacgaatacgaccccaccatcgaggactcctac
cggaagcaagtggtcattgacggggagacgtgtctgctggacattctggacacggccggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc
gtgttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctggtaggaaacaagtgtgacttg
gctgcacgcaccgtggagtctcggcaggcgcaagacctggcccgcagctacggcatcccc
tacgtcgagacctcggccaagacgcgccagggcagccgctctggctctggctccagctcc
gggacccccgggacccagcggcccctcgcgctggcgtggaggacgccttctacacgctgg
tgcgcgagattcggcagcacaaggtgcgcaagctga

DBGET integrated database retrieval system