Pteropus vampyrus (large flying fox): 105307127 Help Entry 105307127         CDS       T07815                                  Name (RefSeq) fibroblast growth factor 19-like   KO K22603   fibroblast growth factor 19 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04010   MAPK signaling pathway pvp04014   Ras signaling pathway pvp04015   Rap1 signaling pathway pvp04020   Calcium signaling pathway pvp04151   PI3K-Akt signaling pathway pvp04810   Regulation of actin cytoskeleton pvp05200   Pathways in cancer pvp05218   Melanoma pvp05224   Breast cancer pvp05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105307127    04014 Ras signaling pathway     105307127    04015 Rap1 signaling pathway     105307127    04020 Calcium signaling pathway     105307127    04151 PI3K-Akt signaling pathway     105307127  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105307127  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105307127   09162 Cancer: specific types    05226 Gastric cancer     105307127    05218 Melanoma     105307127    05224 Breast cancer     105307127  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pvp04052]     105307127    00536 Glycosaminoglycan binding proteins [BR:pvp00536]     105307127 Cytokines and neuropeptides [BR:pvp04052]  Cytokines   Growth factors (RTK binding)    105307127 Glycosaminoglycan binding proteins [BR:pvp00536]  Heparan sulfate / Heparin   Growth factors/receptors    105307127 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  105307127 NCBI-ProteinID:  XP_011380786 UniProt:  A0A6P3RIA6 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MRSPCAVARALVLAGLWLASAAGPLALSDAGPHVHYGWGEAIRLRHLYTAGPHGPSSCFL RIRADGAVDCARGQSAHSLVEIRAVALRNVAIKGVHSVRYLCMGADGRMLGLVGVTTRRD ELGRGTYACPRTGPTGKGGRAESNPEFPGFLRWGRHGAPEGVRQRPDEGN NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgcggagcccgtgcgctgtggcccgcgccttggtcctggccggcctctggctggcctca gctgcgggccccctcgccctctcggacgcggggccgcacgtgcactacggctggggcgag gccatccgcctgcggcacctgtacaccgccggcccccacggcccctccagctgcttcctg cgcatccgcgcggatggggcggtggactgcgcgcggggccagagcgcgcacagtttggtg gaaatccgggctgtcgccctgcggaacgtggctatcaagggcgtgcacagcgtccgatac ctctgcatgggagccgacggcaggatgctagggctggtaggtgtcaccaccaggcgggac gagctgggacgcggaacttacgcctgtccccggacagggcctacagggaaagggggtcgc gccgaatcgaatccagagttccctggcttcctccgctggggccggcatggagctcccgag ggagttcgacaaaggccggatgaaggaaactaa

DBGET integrated database retrieval system