Pteropus vampyrus (large flying fox): 105307329 Help Entry 105307329         CDS       T07815                                  Symbol PSMA4 Name (RefSeq) proteasome subunit alpha type-4   KO K02728   20S proteasome subunit alpha 3 [EC:3.4.25.1] Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp03050   Proteasome pvp05010   Alzheimer disease pvp05012   Parkinson disease pvp05014   Amyotrophic lateral sclerosis pvp05016   Huntington disease pvp05017   Spinocerebellar ataxia pvp05020   Prion disease pvp05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:pvp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     105307329 (PSMA4)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     105307329 (PSMA4)    05012 Parkinson disease     105307329 (PSMA4)    05014 Amyotrophic lateral sclerosis     105307329 (PSMA4)    05016 Huntington disease     105307329 (PSMA4)    05017 Spinocerebellar ataxia     105307329 (PSMA4)    05020 Prion disease     105307329 (PSMA4)    05022 Pathways of neurodegeneration - multiple diseases     105307329 (PSMA4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pvp01002]     105307329 (PSMA4)   09182 Protein families: genetic information processing    03051 Proteasome [BR:pvp03051]     105307329 (PSMA4) Enzymes [BR:pvp01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      105307329 (PSMA4) Peptidases and inhibitors [BR:pvp01002]  Threonine peptidases   Family T1: proteasome family    105307329 (PSMA4) Proteasome [BR:pvp03051]  Eukaryotic proteasome   Core particles (20S proteasome)    alpha type subunits     105307329 (PSMA4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Proteasome Phenol_monoox Motif Other DBs NCBI-GeneID:  105307329 NCBI-ProteinID:  XP_011381088 UniProt:  A0A6P3RIY0 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MYVFQKNPSICTSFDSRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGW DKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNK TMDVSKLSAEKGSLCPLL NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgtatgtgtttcagaaaaacccatcaatatgcacatcttttgattctaggtacttacta cagtatcaggagccaattccttgtgagcagttggttacagctctgtgtgatatcaaacaa gcttatacacagtttggaggaaaacgtccctttggcgtctcgctgctgtacattggctgg gataagcactacggctttcagctctatcagagcgacccgagtgggaactatgggggatgg aaagccacgtgcattggaaataatagcgccgcagccgtgtcaatgttaaaacaagactac aaagaaggagaaatgactctgaagtcagcgctcgctttagccatcaaagtcctcaacaag accatggatgttagcaaactctctgcggagaaaggtagtttatgtcctctcctctga

DBGET integrated database retrieval system